Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2141 to 2150 (of 2644 Products)
Price Product Name
$454.00
... more info

PDKtide PDK1 Kinase Substrate

Catalog Number LT8929 Product Name PDKtide PDK1 Kinase Substrate Product Quantity 1 mg Sequence [protein fragment, 39 aa] Molecular Weight 4771.6 Formula C212H314N54O66S3 Purity ≥95% Scientific Background PDKtide is a 40-residue...
$90.00
... more info

Penetratin Cell-Penetrating Peptide

Catalog Number LT9002 Product Name Penetratin Cell-Penetrating Peptide Product Quantity 1 mg Sequence RQIKIWFQNRRMKWKKGG Molecular Weight 2361.0 Formula C108H174N36O22S Purity ≥95% Scientific Background Penetratin is a classic cell-penetrating...
... more info

Penetratin-GG Cell-Penetrating Peptide

Product Name Penetratin-GG Cell-Penetrating Peptide Product Quantity 4 mg Catalog Number LT8738 Sequence RQIKIWFQNRRMKWKKGG Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Gly-Gly Purity >95% Peptide Type Antennapedia-derived...
$285.12
... more info

Pentagastrin

Product Name Pentagastrin Product Quantity 5mg Catalog Number LT2028 Molecular Weight 768.79 Formula C37H50N7O9S1 Sequence Boc-beta-Ala-Trp-Met-Asp-Phe-NH2 Scientific Background Pentagastrin is a 5-residue synthetic peptide with the sequence Ala-Trp...
$265.68
... more info

Pep 4A

Product Name Pep 4A Product Quantity 5mg Catalog Number LT2029 Molecular Weight 1424.77 Formula C63H117N21O16 Sequence Gly-Ser-Val-Val-I le-Val-Gly-Arg-Ile-Ile-Leu-Ser-Gly-Arg-NH2 Scientific Background Pep 4A is a 13-residue synthetic peptide with...
$324.00
... more info

Pep 4AK

Product Name Pep 4AK Product Quantity 5mg Catalog Number LT2030 Molecular Weight 1809.29 Formula C81H153N27O19 Sequence Lys-Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Ile-Leu-Ser-Gly-Arg-NH2 Scientific Background Pep 4AK is a 17-residue synthetic...
$375.84
... more info

Pep-1

Product Name Pep-1 Product Quantity 5mg Catalog Number LT2031 Molecular Weight 2848.29 Formula C136H195N35O33 Sequence Lys-Glu-Thr-Trp-Trp-Glu-Thr-Trp-Trp-Thr-Glu-Trp-Ser-Gln-Pro-Lys-Lys-Lys-Arg-Lys-Val Product Description PEP-1 peptide, which has...
$211.00
... more info

Pep-1-Cysteamine Cell-Penetrating Peptide

Catalog Number LT8886 Product Name Pep-1-Cysteamine Cell-Penetrating Peptide Product Quantity 1 mg Sequence Ac-KETWWETWWTEWSQPKKKRKV-cysteamine CAS Number 863608-35-9 Molecular Weight 2949.5 Formula C140H202N36O33S Purity ≥95% Scientific...
$344.00
... more info

PEP1 HCV NS5A Amphipathic Helix Peptide

Catalog Number LT8856 Product Name PEP1 HCV NS5A Amphipathic Helix Peptide Product Quantity 1 mg Sequence SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2 Molecular Weight 3805.5 Formula C177H259N43O49S Purity ≥95% Scientific Background ...
$557.28
... more info

Peptide B, bovine

Product Name Peptide B, bovine Product Quantity 5mg Catalog Number LT2032 Molecular Weight 3657.08 Formula C163H239N39O53S2 Sequence Phe-Ala-Glu-Pro-Leu-Pro-Ser-Glu-Glu-Glu-Gly-Glu-Ser-Tyr-Ser-Lys-Glu-Val-Pro-Glu-Met-Glu-Lys-Arg-Tyr-Gly-Gly-Phe-Met-A...
Displaying 2141 to 2150 (of 2644 Products)