Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2091 to 2100 (of 2644 Products)
Price Product Name
$2,008.80
... more info

PACAP(1-38)-Lys(Biotin),amide, human, ovine, rat

Product Name PACAP(1-38)-Lys(Biotin), amide, human, ovine, rat Product Quantity 5mg Catalog Number LT1980 Molecular Weight 4888.83 Formula C219H357N67O56S2 Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-T...
$308.88
... more info

PAKtide

Product Name PAKtide Product Quantity 10mg Catalog Number LT1990 Molecular Weight 1188.36 Formula C51H85N19O14 Sequence Arg-Arg-Arg-Leu-Ser-Phe-Ala-Glu-Pro-Gly Scientific Background PAKtide is a synthetic defined protein-kinase substrate or...
$350.00
... more info

Palmitoyl-TRPASFWETS

Product Name Palmitoylated Anti-Fibrotic Peptide: Palmitoyl-spacer-TRPASFWETS Catalog Number LT8317 Product Quantity 5 mg, >95% Purity Sequence Palmitoyl-spacer-TRPASFWETS; Related product: TRPASFWETS Modification N-terminal...
$347.00
... more info

Pancreastatin (24-52), Human, Amide

Catalog Number LT8851 Product Name Pancreastatin (24-52), Human, Amide Product Quantity 1 mg Sequence PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 Molecular Weight 3283.53 Formula C138H216N40O51S Purity ≥95% Scientific Background ...
$245.00
... more info

Pancreastatin (33-49), Human

Catalog Number LT9347 Product Name Pancreastatin (33-49), Human Product Quantity 1 mg Sequence GWTQNSRLRGELSAV-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Pancreastatin is a chromogranin A-derived regulatory peptide. The C-termi...
$2,643.84
... more info

Pancreastatin, porcine

Product Name Pancreastatin, porcine Product Quantity 5mg Catalog Number LT1991 Molecular Weight 5103.4 Formula C214H330N68O76S Sequence Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-Thr-Gly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Gl...
$881.28
... more info

Pancreatic Polypeptide (1-17)-(Ala31,Aib32)-Neuropeptide Y (18-3

Product Name Pancreatic Polypeptide (1-17)-(Ala31, Aib32)-Neuropeptide Y (18-3 Product Quantity 5mg Catalog Number LT1992 Molecular Weight 4124.7 Formula C185H280N54O52S1 Sequence Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Al...
$187.92
... more info

Pancreatic Polypeptide (31-36) (free acid) (human)

Product Name Pancreatic Polypeptide (31-36) (free acid) (human) Product Quantity 10mg Catalog Number LT1993 Molecular Weight 805 Formula C36H60N12O9 Sequence Leu-Thr-Arg-Pro-Arg-Tyr Scientific Background Pancreatic Polypeptide (31-36) (free acid) (h...
$209.52
... more info

Pancreatic Polypeptide (31-36) (human)

Product Name Pancreatic Polypeptide (31-36) (human) Product Quantity 10mg Catalog Number LT1994 Molecular Weight 804 Formula C36H61N13O8 Sequence Leu-Thr-Arg-Pro-Arg-Tyr-NH2 Scientific Background Pancreatic Polypeptide (31-36) (human) is a...
$881.28
... more info

Pancreatic Polypeptide (bovine)

Product Name Pancreatic Polypeptide (bovine) Product Quantity 5mg Catalog Number LT1995 Molecular Weight 4225.81 Formula C186H287N53O56S2 Sequence Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg...
Displaying 2091 to 2100 (of 2644 Products)