Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1371 to 1380 (of 2644 Products)
Price Product Name
$758.16
... more info

Gastrin Releasing Peptide-Lys(Biotin), human

Product Name Gastrin Releasing Peptide-Lys(Biotin), human Product Quantity 5mg Catalog Number LT1475 Molecular Weight 2859.3 Formula C130H204N38O31S2 Sequence Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val...
$498.96
... more info

Gastrin Releasing Peptide,human

Product Name Gastrin Releasing Peptide,human Product Quantity 5mg Catalog Number LT1473 Molecular Weight 2859.4 Formula C130H204N38O31S2 Sequence Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-...
$498.96
... more info

Gastrin Releasing Peptide,procine

Product Name Gastrin Releasing Peptide, procine Product Quantity 5mg Catalog Number LT1474 Molecular Weight 2805.4 Formula C126H198N38O31S2 Sequence Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-L...
$205.20
... more info

Gastrin Tetrapeptide

Product Name Gastrin Tetrapeptide Product Quantity 10mg Catalog Number LT1476 Molecular Weight 596.71 Formula C29H36N6O6S Sequence Trp-Met-Asp-Phe-NH2 Scientific Background Gastrin Tetrapeptide is a synthetic research peptide in the gastrin /...
$838.08
... more info

Gastrin-1, human

Product Name Gastrin-1, human Product Quantity 5mg Catalog Number LT1478 Molecular Weight 2098.22 Formula C97H125N20O31S Sequence Pyr-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 Scientific Background Gastrin-1, human is a...
$131.00
... more info

Gastrin-1, Human (Gastrin-17)

Catalog Number LT9338 Product Name Gastrin-1, Human (Gastrin-17) Product Quantity 1 mg Sequence Pyr-GPWLEEEEEAYGWMDF-NH2 Molecular Weight 2098.3 Purity ≥95% Scientific Background Gastrin-17, or little gastrin, is a major bioactive...
$838.08
... more info

Gastrin-1, rat

Product Name Gastrin-1, rat Product Quantity 5mg Catalog Number LT1479 Molecular Weight 2126.32 Formula C94H128N22O31S2 Sequence Pyr-Arg-Pro-Pro-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 Scientific Background Gastrin-1, rat is a...
$424.00
... more info

Gastrin-Releasing Peptide (GRP), Human

Catalog Number LT9265 Product Name Gastrin-Releasing Peptide (GRP), Human Product Quantity 1 mg Sequence VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Gastrin-releasing peptide is a mammalian bombesin-f...
$1,453.68
... more info

Gastrin, chicken

Product Name Gastrin, chicken Product Quantity 5mg Catalog Number LT1477 Molecular Weight 4055.58 Formula C190H265N47O51S1 Sequence Phe-Leu-Pro-His-Val-Phe-Ala-Glu-Leu-Ser-Asp-Arg-Lys-Gly-Phe-Val-Gln-Gly-Asn-Gly-Ala-Val-Glu-Ala-Leu-His-Asp-Phe-Tyr-Pr...
$472.00
... more info

Generic MMP FRET Substrate, Mca-PLGL-Dap(Dnp)-AR

Catalog Number LT8774 Product Name Generic MMP FRET Substrate, Mca-PLGL-Dap(Dnp)-AR Product Quantity 5 mg Sequence Mca-PLGL-Dap(Dnp)-AR Molecular Weight 1094.2 Formula C43H65N11O12 Purity ≥95% Scientific Background Mca-PLGL-Dap(Dnp)-AR is an...
Displaying 1371 to 1380 (of 2644 Products)