Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1341 to 1350 (of 2644 Products)
Price Product Name
$320.00
... more info

GAD65 (524-543)

Catalog Number LT9391 Product Name GAD65 (524-543) Product Quantity 1 mg Sequence SRLSKVAPVIKARMMEYGTT Molecular Weight TBD Purity ≥95% Scientific Background GAD65(524-543) is a C-terminal glutamic acid decarboxylase epitope used in...
$356.40
... more info

GAD65 (78–97)

Product Name GAD65 (78–97) Product Quantity 5mg Catalog Number LT1454 Molecular Weight 2206.53 Formula C97H148N26O29S2 Sequence Lys-Pro-Cys-Asn-Cys-Pro-Lys-Gly-Asp-Val-Asn-Tyr-Ala-Phe-Leu-His-Ala-Thr-Asp-Leu Scientific Background GAD65 (78–97) is a...
$469.00
... more info

GALA, Pore-Forming Peptide

Catalog Number LT9427 Product Name GALA, Pore-Forming Peptide Product Quantity 1 mg Sequence WEAALAEALAEALAEHLAEALAEALEALAA Molecular Weight 3032.4 Purity ≥95% Scientific Background GALA is a synthetic 30-residue pH-responsive membrane-a...
$466.56
... more info

Galanin (1-13)-Neuropeptide Y (25-36), amide (M32)

Product Name Galanin (1-13)-Neuropeptide Y (25-36), amide (M32) Product Quantity 5mg Catalog Number LT1455 Molecular Weight 2962.4 Formula C136H209N41O34 Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg...
$589.68
... more info

Galanin (1-13)-Spantide I

Product Name Galanin (1-13)-Spantide I Product Quantity 5mg Catalog Number LT1456 Molecular Weight 2828.34 Formula C138H199N35O30 Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2...
$285.12
... more info

Galanin (1-16), porcine, rat

Product Name Galanin (1-16), porcine, rat Product Quantity 5mg Catalog Number LT1457 Molecular Weight 1669.92 Formula C78H116N20O21 Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile Scientific Background Galanin (1-16),...
$454.00
... more info

Galanin (1-29), Human

Catalog Number LT9225 Product Name Galanin (1-29), Human Product Quantity 1 mg Sequence GWTLNSAGYLLGPHAVDNHRSFSDKHGLT-NH2 Molecular Weight 3156.6 Purity ≥95% Scientific Background Human galanin is a neuropeptide involved in feeding,...
$469.00
... more info

Galanin (1-29), Rat

Catalog Number LT9226 Product Name Galanin (1-29), Rat Product Quantity 1 mg Sequence GWTLNSAGYLLGPHAVDNHRSFSDKNGLTS-NH2 Molecular Weight 3165.6 Purity ≥95% Scientific Background Rat galanin is a widely used species-specific ligand for GAL...
$194.40
... more info

Galanin (2-11)

Product Name Galanin (2-11) Product Quantity 5mg Catalog Number LT1458 Molecular Weight 1136.33 Formula C54H81N13O14 Sequence Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-NH2 Scientific Background Galanin (2-11) is a synthetic research peptide in the...
$1,004.40
... more info

Galanin Message Associated Peptide (1-41), amide; GMAP (1-41), a

Product Name Galanin Message Associated Peptide (1-41), amide; GMAP (1-41), a Product Quantity 5mg Catalog Number LT1459 Molecular Weight 4643.3 Formula C206H326N56O64S Sequence Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-...
Displaying 1341 to 1350 (of 2644 Products)