Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1171 to 1180 (of 2644 Products)
Price Product Name
$856.00
... more info

Des-gamma-carboxylated Osteocalcin / Bone Gla Protein

Catalog Number LT9337 Product Name Des-gamma-carboxylated Osteocalcin / Bone Gla Protein Product Quantity 0.25 mg Sequence YLYQWLGAPVPYPDPLEPRREVCELNPDCDLADHIGFQEAYRRFYGPV Molecular Weight 5797.8 Purity ≥95% Scientific Background Des-gam...
$564.00$370.00Save: 34% off
... more info

Desmopressin, DDAVP, (Deamino-Cys1,D-Arg8)-Vasopressin

Product Name Desmopressin, DDAVP, (Deamino-Cys1, D-Arg8)-Vasopressin Product Quantity 5mg Catalog Number LT1331 Molecular Weight 1069.1 Formula C46H64N14O12S2 Sequence Map-Tyr-Phe-Gln-Asn-Cys-Pro-D-Arg-Gly-NH2 (Disulfide bridge, Map1-Cys6), 3-Mercapt...
$152.00
... more info

DGEA Collagen-Derived Peptide

Catalog Number LT9464 Product Name DGEA Collagen-Derived Peptide Product Quantity 5 mg Sequence / Structure DGEA Purity ≥95% Scientific Background DGEA is a short collagen-derived peptide historically used to probe α2β1 integrin-depe...
$356.40
... more info

Diazepam-Binding Inhibitor Fragment, human

Product Name Diazepam-Binding Inhibitor Fragment, human Product Quantity 5mg Catalog Number LT1332 Molecular Weight 2150.41 Formula C91H148N26O32S Sequence Gln-Ala-Thr-Val-Gly-Asp-Ile-Asn-Thr-Glu-Arg-Pro-Gly-Met-Leu-Asp-Phe-Thr-Gly-Lys Scientific...
$440.00
... more info

DNA-PK Substrate Peptide, EPPLSQEAFADLWKK

Catalog Number LT8754 Product Name DNA-PK Substrate Peptide, EPPLSQEAFADLWKK Product Quantity 5 mg Sequence EPPLSQEAFADLWKK Molecular Weight 1759.1 Formula C82H123N19O24 Purity ≥95% Scientific Background EPPLSQEAFADLWKK is a p53-derived...
$285.12
... more info

Doc- 6 (130 - 145)

Product Name Doc- 6 (130 - 145) Product Quantity 5mg Catalog Number LT1333 Molecular Weight 1980.25 Formula C86H134N26O26S Sequence Gly-Val-Gln-Arg-Glu-Gln-Asn-Glu-Arg-Phe-Asn-Val-Tyr-Leu-Met-Pro Scientific Background Doc- 6 (130 - 145) is a 16-resi...
$233.28
... more info

Dok- 5 (263 - 275)

Product Name Dok- 5 (263 - 275) Product Quantity 5mg Catalog Number LT1334 Molecular Weight 1655.89 Formula C75H114N24O19 Sequence Leu-Pro-Arg-Ser-Ala-Tyr-Trp-Gln-His-Ile-Thr-Arg-Gln Scientific Background Dok- 5 (263 - 275) is a 13-residue...
$285.12
... more info

Dok-4 (130 - 145)

Product Name Dok-4 (130 - 145) Product Quantity 5mg Catalog Number LT1335 Molecular Weight 1866.1 Formula C83H128N22O25S Sequence Gly-Val-Gln-Cys-Glu-Gln-Thr-Asp-Arg-Phe-Asn-Val-Phe-Leu-Leu-Pro Scientific Background Dok-4 (130 - 145) is a 16-residue...
$233.28
... more info

Dok-4 (263 - 275)

Product Name Dok-4 (263 - 275) Product Quantity 5mg Catalog Number LT1336 Molecular Weight 1524.72 Formula C70H101N21O18 Sequence Leu-Pro-Arg-Ser-Ala-Tyr-Trp-His-His-Ile-Thr-Gly-Ser Scientific Background Dok-4 (263 - 275) is a 13-residue synthetic...
$233.28
... more info

Dok-6 (263 - 275)

Product Name Dok-6 (263 - 275) Product Quantity 5mg Catalog Number LT1337 Molecular Weight 1664.9 Formula C76H113N25O18 Sequence Leu-Pro-Arg-Ser-Ala-Tyr-Trp-His-His-Ile-Thr-Arg-Gln Scientific Background Dok-6 (263 - 275) is a 13-residue synthetic...
Displaying 1171 to 1180 (of 2644 Products)