Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2261 to 2270 (of 2783 Products)
Price Product Name
$169.00
... more info

PD-1 Binding Peptide Ar5Y_2, FNWDYSLEELREKAKYK

Catalog Number LT8760 Product Name PD-1 Binding Peptide Ar5Y_2, FNWDYSLEELREKAKYK Product Quantity 1 mg Sequence FNWDYSLEELREKAKYK Molecular Weight 2219.6 Formula C103H151N25O30 Purity ≥95% Scientific Background FNWDYSLEELREKAKYK (Ar5Y_2) is...
$169.00
... more info

PD-1 Binding Peptide Ar5Y_3, TEKDYRHGNIRMKLAYDL

Catalog Number LT8761 Product Name PD-1 Binding Peptide Ar5Y_3, TEKDYRHGNIRMKLAYDL Product Quantity 1 mg Sequence TEKDYRHGNIRMKLAYDL CAS Number 2135542-84-4 Molecular Weight 2223.7 Formula C97H155N29O29S Purity ≥95% Scientific Background ...
$208.00
... more info

PD-1 Binding Peptide Ar5Y_4, GNWDYNSQRAQLYNQ

Catalog Number LT8762 Product Name PD-1 Binding Peptide Ar5Y_4, GNWDYNSQRAQLYNQ Product Quantity 1 mg Sequence GNWDYNSQRAQLYNQ Molecular Weight 1857.0 Formula C80H113N25O27 Purity ≥95% Scientific Background GNWDYNSQRAQLYNQ (Ar5Y_4) is a de...
$259.20
... more info

PDGF Beta-Receptor (739-746) (phosphorylated)

Product Name PDGF Beta-Receptor (739-746) (phosphorylated) Product Quantity 5mg Catalog Number LT2026 Molecular Weight 1116.14 Formula C48H62N9O18PS Sequence Tyr(PO3H2)-Met-Ala-Pro-Tyr-Asp-Asn-Tyr Scientific Background PDGF Beta-Receptor (739-746)...
$260.00
... more info

PDGFR-beta pTyr1021 Peptide

Catalog Number LT9482 Product Name PDGFR-beta pTyr1021 Peptide Product Quantity 1 mg Sequence NEGDNDpYIIPLPDPK Purity ≥95% Scientific Background PDGFR-beta Tyr1021 is a receptor autophosphorylation site involved in PLC-gamma recruitment. Its...
$245.00
... more info

PDGFR-beta pTyr751 Peptide

Catalog Number LT9481 Product Name PDGFR-beta pTyr751 Peptide Product Quantity 1 mg Sequence DESVDpYVPMLDMKG Purity ≥95% Scientific Background PDGFR-beta pTyr751 forms a docking site for PI3K-associated signaling proteins. The phosphopeptide...
$270.00
... more info

PDGFRtide

Product Name PDGFRtide Product Quantity 10mg Catalog Number LT2027 Molecular Weight 1185.26 Formula C54H76N10O20 Sequence Gln-Glu-Glu-Glu-Tyr-Val-Phe-Ile-Glu Scientific Background PDGFRtide is a 9-residue synthetic peptide with the sequence...
$454.00
... more info

PDKtide PDK1 Kinase Substrate

Catalog Number LT8929 Product Name PDKtide PDK1 Kinase Substrate Product Quantity 1 mg Sequence [protein fragment, 39 aa] Molecular Weight 4771.6 Formula C212H314N54O66S3 Purity ≥95% Scientific Background PDKtide is a 40-residue...
$90.00
... more info

Penetratin Cell-Penetrating Peptide

Catalog Number LT9002 Product Name Penetratin Cell-Penetrating Peptide Product Quantity 1 mg Sequence RQIKIWFQNRRMKWKKGG Molecular Weight 2361.0 Formula C108H174N36O22S Purity ≥95% Scientific Background Penetratin is a classic...
... more info

Penetratin-GG Cell-Penetrating Peptide

Product Name Penetratin-GG Cell-Penetrating Peptide Product Quantity 4 mg Catalog Number LT8738 Sequence RQIKIWFQNRRMKWKKGG Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Gly-Gly Purity >95% Peptide Type Antennapedia-derived...
Displaying 2261 to 2270 (of 2783 Products)