Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2201 to 2210 (of 2783 Products)
Price Product Name
$308.88
... more info

PA (224–233), Influenza

Product Name PA (224–233), Influenza Product Quantity 10mg Catalog Number LT1978 Molecular Weight 1185.31 Formula C53H80N14O17 Sequence Ser-Ser-Leu-Glu-Asn-Phe-Arg-Ala-Tyr-Val Scientific Background PA (224–233), Influenza is a synthetic...
$136.00
... more info

PACAP (1-27), Amide, Human/Ovine/Rat

Catalog Number LT9208 Product Name PACAP (1-27), Amide, Human/Ovine/Rat Product Quantity 0.5 mg Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 Molecular Weight 3147.8 Purity ≥95% Scientific Background PACAP-27 is the N-terminal 27-residue...
$486.00
... more info

PACAP (1-38)-Lys(Biotin), Amide, Human/Ovine/Rat

Catalog Number LT9206 Product Name PACAP (1-38)-Lys(Biotin), Amide, Human/Ovine/Rat Product Quantity 0.5 mg Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2 Molecular Weight 4889.0 Purity ≥95% Scientific Background This...
$344.00
... more info

PACAP (1-38), Amide, Biotin-Labeled, Human/Ovine/Rat

Catalog Number LT9205 Product Name PACAP (1-38), Amide, Biotin-Labeled, Human/Ovine/Rat Product Quantity 0.5 mg Sequence Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 Molecular Weight 4760.8 Purity ≥95% Scientific Background This...
$194.00
... more info

PACAP (1-38), Amide, Human/Ovine/Rat

Catalog Number LT9204 Product Name PACAP (1-38), Amide, Human/Ovine/Rat Product Quantity 0.5 mg Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 Molecular Weight 4534.5 Purity ≥95% Scientific Background PACAP-38 is a conserved...
$1,367.28
... more info

PACAP (1-38), human, ovine,rat

Product Name PACAP (1-38), human, ovine, rat Product Quantity 5mg Catalog Number LT1979 Molecular Weight 4534.36 Formula C203H331N63O53S1 Sequence...
$182.00
... more info

PACAP (6-38), Amide, Human/Ovine/Rat

Catalog Number LT9207 Product Name PACAP (6-38), Amide, Human/Ovine/Rat Product Quantity TBD Sequence FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 Molecular Weight 4025.0 Purity ≥95% Scientific Background PACAP(6-38) is a truncated PACAP...
$414.72
... more info

PACAP-27 (6-27) (human,chicken, mouse, ovine,porcine, rat)

Product Name PACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat) Product Quantity 5mg Catalog Number LT1981 Molecular Weight 2638.15 Formula C121H193N33O30S Sequence...
$498.96
... more info

PACAP-27 (human, mouse,ovine, porcine, rat)

Product Name PACAP-27 (human, mouse, ovine, porcine, rat) Product Quantity 5mg Catalog Number LT1982 Molecular Weight 3147.68 Formula C142H224N40O39S1 Sequence...
$427.68
... more info

PACAP-38 (16-38) (human,chicken, mouse, ovine,porcine, rat)

Product Name PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) Product Quantity 5mg Catalog Number LT1983 Molecular Weight 2720.37 Formula C123H215N39O28S Sequence...
Displaying 2201 to 2210 (of 2783 Products)