My Account Information
Displaying 141 to 150 (of 7698 Products)
| Price | Product Name |
|---|---|
$890.00 ... more info |
Product Name HS-cR10 Product Quantity 5 mg Purity >95% Catalog Number LT8154 Molecular Weight C86H168N47O20S [M + H]+, 2213; [M + 2H]2+,1107; found, 1108 Formula C86H168N47O20S Sequence C-(mini-PEG)-(mini-PEG)-KRrRrRrRrRrE, C-Terminal:... |
$598.80 $299.00Save: 50% off ... more info |
Product NameEcoPNA1169Product Quantity 125nmolCatalog Number LT-PNA003 Purity >95% Sequence Biotin - {CAACACACAGTGTC} Description This Nucleic Acid Mimics (NAMs) sequence 5'-CAA CAC ACA GTG TC-3' hybridizes between positions 1169 and 1183 of... |
$280.00 ... more info |
Catalog Number: 5674-02 Category: mUNO Peptide Sequence: H-CSPGAK-OH Description: UNO selectively targets Mannose Receptor (CD206/MRC1)-expressing Tumor-Associated Macrophages (TAMs), contributing to the suppression of tumor growth,... |
$150.00 ... more info |
Product Name: Neuropeptide Y (human, rat) Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (Modifications: Tyr-36 = C-terminal amide) Product Quantity: 1 mg, 5mg, 10mg Purity: >95% Catalog Number: LT2670 CAS Number: 90880-35-6 Molecular... |
$2,500.00 ... more info |
SARS-CoV2 Omicron XBB.1.5 variant specific RBD/NTD-peptide library SARS-CoV2 Omicron XBB.1.5 variant specific RBD/NTD-peptide library : The current XBB variant of SARS-CoV-2 with the strongest immune escaping properties is currently the most dominant variant circulating around the world. It is highly required to... |
$150.00 ... more info |
Antennapedia Peptide, FAM-labeled Product Name Antennapedia Peptide, FAM-labeled, penetratin Catalog #LT8157 Quantity1mg Purity >98% Price $ 150 In stock Sequence{5-FAM}-RQIKIWFQNRRMKWKK DescriptionThe DNA binding domain of the Drosophila transcription factor... |
$150.00 ... more info |
Product Name Cys(Npys) FITC-LC-Antennapedia Peptide, penetratin Catalog #LT8156 Quantity1mg Purity >98% Price $ 150 In stock Sequence{FITC-LC}-RQIKIWFQNRRMKWKK DescriptionThe DNA binding domain of the Drosophila transcription... |
$150.00 ... more info |
Cys(Npys) Antennapedia Peptide, amide Product Name Cys(Npys) Antennapedia Peptide, amide, penetratin Catalog #LT8155 Quantity1mg Purity >98% Price $ 150 In stock SequenceC(Npys)-RQIKIWFQNRRMKWKK DescriptionThe DNA binding domain of the Drosophila transcription factor... |
$99.00 ... more info |
Buy one FLAG antibody, Get one FLAG peptide for free. Choice of FLAG peptide, 3X FLAG peptide or FLAG-Cysteine peptide. Use Code: FREEFLAG When Checkout. Order anti-DYKDDDDK monoclonal antibody from here. Product Name 3X DYKDDDDK Peptide, DYKDDDDK... |
$99.00 ... more info |
Product Name(Arg)9, Cys C-term, RRRRRRRRRCProduct Description The peptide has nine Arginine residues and is modified with an activated cysteine residue C(Npys). The Npys is 3-Nitro-2-pyridinesulfenyl group-protected cysteine. The peptide is used as... |
Displaying 141 to 150 (of 7698 Products)
