Neuropeptide Y

Product Name
Neuropeptide Y
Product Quantity
1 mg, 5mg, 10mg
Catalog Number
LT2670
Molecular Weight
4271.7
Formula
C189H285N55O57S
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (Modifications: Tyr-36 = C-terminal amide)
Purity
>95%
CAS Number
90880-35-6
Product Description
human Neuropeptide Y Peptide

Neuropeptide Y (NPY) is a versatile peptide found abundantly in both the central and peripheral nervous systems. It serves as a crucial regulator for various physiological functions, including appetite control, blood pressure regulation, cardiac contractility, and intestinal secretion. NPY achieves its effects by binding to specific receptors in the body, such as the Y1 and Y5 subtypes which stimulate feeding, and the Y2 and Y4 subtypes which promote satiety.

In the realm of scientific study, NPY has garnered significant attention due to its multifaceted roles. Researchers utilize NPY and its receptors as valuable tools to investigate and understand intricate processes in the body. Its applications span across diverse fields, including neurobiology, endocrinology, and immunology.

  1. Neurobiology: NPY is instrumental in unraveling the complex mechanisms of appetite regulation and the neural circuits governing hunger and satiety. Studying NPY can provide insights into conditions like obesity and eating disorders.

  2. Endocrinology: NPY's involvement in blood pressure control and cardiac function makes it a subject of interest for cardiovascular research. Scientists explore NPY's role in hypertension and heart-related diseases.

  3. Gastrointestinal Research: NPY's influence on intestinal secretion is relevant in gastrointestinal studies. Its interaction with the gut's immune system and antimicrobial properties make it an intriguing candidate for investigating digestive health and immunity.

In summary, Neuropeptide Y is a versatile peptide with a broad range of functions in the body. Its applications in scientific research help advance our understanding of various physiological processes and hold promise for potential therapeutic interventions in the future.

Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure.

Reference: Acton D, Ren X, Di Costanzo S, Dalet A, Bourane S, Bertocchi I, Eva C, Goulding M. Spinal Neuropeptide Y1 Receptor-Expressing Neurons Form an Essential Excitatory Pathway for Mechanical Itch. Cell Rep. 2019 Jul 16;28(3):625-639. e6. doi: 10.1016/j. celrep.2019.06.033. PMID: 31315043; PMCID: PMC6709688.

Scientific Background

Neuropeptide Y is a synthetic research peptide in the neuropeptide Y (NPY) family. Neuropeptide Y is a 36-residue peptide ligand for Y-family GPCRs. N-terminal processing can strongly change receptor selectivity; NPY(3-36), for example, retains high Y2 affinity while losing much of the Y1 affinity of NPY(1-36).

Research Applications
  • Y-receptor binding assays
  • NPY receptor subtype studies
  • processed-peptide structure-activity comparisons
Experimental Notes

The exact sequence, residue range, species, terminal state, and chemical modifications should be matched to the intended assay. Fragmentation or processing can materially alter receptor selectivity, potency, aggregation, or enzymatic behavior.

Selected References
  1. NPY(3-36) is an endogenous Y2-selective ligand
  • 5 Units in Stock
Ask a Question

Starting at: $150.00

Please Choose:

Starting at: $150.00

Add to Cart: