My Account Information
Displaying 131 to 140 (of 7692 Products)
| Price | Product Name |
|---|---|
$350.00 $99.00Save: 72% off ... more info |
Catalog Number: LT8172 Category: Peptide Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, amidation Chemistry : Sequence: NH2- His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala -... |
$350.00 $99.00Save: 72% off ... more info |
Catalog Number: LT8171 Category: Peptide Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, amidation Chemistry : Sequence:... |
$262.00 ... more info |
HIV-1 tat Protein TAT (47-57)-Cys, TAT-Cys C-term Product Name HIV-1 tat Protein TAT (47-57)-Cys, TAT-Cys C-termProduct Quantity5mg Product Description This is the most characterized fragment of the HIV transactivator protein (TAT) YGRKKRRQRRR. This arginine-rich TAT peptide penetrates the plasma... |
$650.00 ... more info |
Biotinylated Human KRAS G12V (HLA-A*02:01) Protein (LTP10000) Product NameBiotinylated Human KRAS G12V (HLA-A*02:01) Protein (LTP10000) Catalog NumberLTP10000 Quantity100ug Price $ 650 In stock BackgroundKirsten rat sarcoma 2 viral oncogene homolog (KRAS) is the most commonly mutated oncogene in human... |
$890.00 ... more info |
Product Name HS-cR10 Product Quantity 5 mg Purity >95% Catalog Number LT8154 Molecular Weight C86H168N47O20S [M + H]+, 2213; [M + 2H]2+,1107; found, 1108 Formula C86H168N47O20S Sequence C-(mini-PEG)-(mini-PEG)-KRrRrRrRrRrE, C-Terminal:... |
$598.80 $299.00Save: 50% off ... more info |
Product NameEcoPNA1169Product Quantity 125nmolCatalog Number LT-PNA003 Purity >95% Sequence Biotin - {CAACACACAGTGTC} Description This Nucleic Acid Mimics (NAMs) sequence 5'-CAA CAC ACA GTG TC-3' hybridizes between positions 1169 and 1183 of... |
$280.00 ... more info |
Catalog Number: 5674-02 Category: mUNO Peptide Sequence: H-CSPGAK-OH Description: UNO selectively targets Mannose Receptor (CD206/MRC1)-expressing Tumor-Associated Macrophages (TAMs), contributing to the suppression of tumor growth,... |
$150.00 ... more info |
Product Name: Neuropeptide Y (human, rat) Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (Modifications: Tyr-36 = C-terminal amide) Product Quantity: 1 mg, 5mg, 10mg Purity: >95% Catalog Number: LT2670 CAS Number: 90880-35-6 Molecular... |
$2,500.00 ... more info |
SARS-CoV2 Omicron XBB.1.5 variant specific RBD/NTD-peptide library SARS-CoV2 Omicron XBB.1.5 variant specific RBD/NTD-peptide library : The current XBB variant of SARS-CoV-2 with the strongest immune escaping properties is currently the most dominant variant circulating around the world. It is highly required to... |
$150.00 ... more info |
Antennapedia Peptide, FAM-labeled Product Name Antennapedia Peptide, FAM-labeled, penetratin Catalog #LT8157 Quantity1mg Purity >98% Price $ 150 In stock Sequence{5-FAM}-RQIKIWFQNRRMKWKK DescriptionThe DNA binding domain of the Drosophila transcription factor... |
Displaying 131 to 140 (of 7692 Products)
