Product Name | Peptide YY (3-36), human |
Product Quantity | 1mg |
Catalog Number | LT8171 |
Category | Peptide |
Sequence | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, amidation |
Purity | >95% |
Chemistry | - Sequence: H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
- CAS registry number: 123583-37-9
- Formular: C180H279N53O54
- Molecular Weight: 4049.7
|
Product Description | 
This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake. Peptide YY-3 exhibits unique chemical and physical properties due to its complex structure. It has a high degree of complexity and a significant number of stereocenters, reflecting its intricate three-dimensional configuration. These properties contribute to its biological functions and interactions within the human body. |
Scientific Background | Peptide YY (3-36), human is a synthetic research peptide in the peptide YY (PYY) family. Peptide YY circulates principally as PYY(1-36) and the DPP-IV-processed PYY(3-36). PYY(1-36) interacts with several Y-receptor subtypes, whereas PYY(3-36) shows strong preference for Y2 receptors, making the fragment useful for receptor-selectivity studies. |
Research Applications | - Y2 receptor assays
- PYY processing studies
- PYY(1-36) versus PYY(3-36) comparisons
|
Experimental Notes | The exact sequence, residue range, species, terminal state, and chemical modifications should be matched to the intended assay. Fragmentation or processing can materially alter receptor selectivity, potency, aggregation, or enzymatic behavior. |
Selected References | - PYY(1-36) and PYY(3-36): distribution, release and actions
|
