Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 681 to 690 (of 2644 Products)
Price Product Name
$450.00
... more info

Beta-Amyloid (1-28)

Product Name Beta-Amyloid (1-28) Product Quantity 5mg Catalog Number LT2455 Molecular Weight 3262.53 Formula C145H209N41O46 Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys,...
$650.00
... more info

Beta-Amyloid (1-39)

Product Name Beta-Amyloid (1-39) Product Quantity 5mg Catalog Number LT2457 Molecular Weight 1918.3 Formula C81H128N32O19S2 Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-A...
$650.00
... more info

Beta-Amyloid (1-40)

Product Name Beta-Amyloid (1-40) Product Quantity 5 mg Catalog Number LT2459 Molecular Weight 4329.9 Formula C194H295N53O58S1 Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly...
$367.00
... more info

Beta-Amyloid (1-40) S26C

Product Name Beta-Amyloid (1-40) S26C Catalog Number LT9148 Sequence DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV Mutation S26C Molecular Weight 4346.2 Purity ≥95% Mechanism & Biological Significance The S26C substitution introduces a...
$177.00
... more info

Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Mouse/Rat

Catalog Number LT9164 Product Name Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Mouse/Rat Product Quantity 0.1 mg Sequence DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2 Molecular Weight 4587.5 Purity ≥95% Scientific Background This...
$277.00
... more info

Beta-Amyloid (1-40)-Lys(LC-biotin)-NH2, FAM-Labeled

Product Name Beta-Amyloid (1-40)-Lys(LC-biotin)-NH2, FAM-Labeled Catalog Number LT9143 Product Quantity 0.1 mg Sequence 5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(LC-BIOTIN)-NH2 Molecular Weight 5155.1 Purity ≥95% Mechanism &...
$664.00
... more info

Beta-Amyloid (1-40), FAM-Labeled

Catalog Number LT9177 Product Name Beta-Amyloid (1-40), FAM-Labeled Product Quantity TBD Sequence FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Molecular Weight TBD Purity ≥95% Scientific Background FAM-Aβ(1-40) is a fluorescent...
$351.00
... more info

Beta-Amyloid (1-40), HCl Salt

Product Name Beta-Amyloid (1-40), HCl Salt Catalog Number LT9156 Product Quantity 1 mg Sequence / Form DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl Molecular Weight 4330.2 + HCl Purity ≥95% Mechanism & Biological Significance Aβ40 is a...
$185.00
... more info

Beta-Amyloid (1-40), HFIP-Treated

Product Name Beta-Amyloid (1-40), HFIP-Treated Catalog Number LT9154 Product Quantity 0.5 mg Sequence / Form DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; HFIP-treated Molecular Weight 4330.2 Purity ≥95% Mechanism & Biological Significance ...
$850.00
... more info

Beta-Amyloid (1-40), rat

Product Name Beta-Amyloid (1-40), rat Product Quantity 5mg Catalog Number LT2458 Molecular Weight 4233.81 Formula C190H291N51O57S1 Sequence Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Ly...
Displaying 681 to 690 (of 2644 Products)