Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 621 to 630 (of 2644 Products)
Price Product Name
$233.28
... more info

Apelin-15 (63 - 75)

Product Name Apelin-15 (63 - 75) Product Quantity 5mg Catalog Number LT1011 Molecular Weight 1618.94 Formula C67H119N29O16S Sequence Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met Scientific Background Apelin-15 (63 - 75) is a synthetic...
$272.16
... more info

Apelin-15 (63-77)

Product Name Apelin-15 (63-77) Product Quantity 5mg Catalog Number LT1012 Molecular Weight 1863.24 Formula C81H135N31O18S Sequence Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe Scientific Background Apelin-15 (63-77) is a synthetic...
$275.00
... more info

Apelin-17

Catalog Number LT9290 Product Name Apelin-17 Product Quantity 1 mg Sequence KFRRQRPRLSHKGPMPF Molecular Weight 2134.6 Purity ≥95% Scientific Background Apelin-17 is an endogenous APLNR agonist containing the receptor-active C-terminal apelin...
$586.00
... more info

Apelin-36

Catalog Number LT9291 Product Name Apelin-36 Product Quantity 0.1 mg Sequence LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF Molecular Weight 4194.0 Purity ≥95% Scientific Background Apelin-36 is a longer endogenous apelin isoform derived from...
$648.00
... more info

Apelin-36, human

Product Name Apelin-36, human Product Quantity 5mg Catalog Number LT1013 Molecular Weight 4195.92 Formula C184H297N69O43S Sequence Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His...
$105.00
... more info

Apidaecin IB

Catalog Number LT9426 Product Name Apidaecin IB Product Quantity 1 mg Sequence GNNRPVYIPQPRPPHPRL Molecular Weight 2108.5 Purity ≥95% Scientific Background Apidaecin IB is a proline-rich honey-bee antimicrobial peptide that acts without...
$252.72
... more info

Aquaporin-2 (254-267), human

Product Name Aquaporin-2 (254-267), human Product Quantity 5mg Catalog Number LT1014 Molecular Weight 1633.84 Formula C69H116N24O22 Sequence Arg-Gln-Ser-Val-Glu-Leu-His-Ser-Pro-Gln-Ser-Leu-Pro-Arg Scientific Background Aquaporin-2 (254-267), human...
$131.00
... more info

Aquaporin-2 (254-267), pSer261, Human

Catalog Number LT9320 Product Name Aquaporin-2 (254-267), pSer261, Human Product Quantity 1 mg Sequence RQSVELH-pS-PQSLPR Molecular Weight 1713.9 Purity ≥95% Scientific Background This human AQP2 C-terminal fragment is phosphorylated at...
$304.56
... more info

Aquaporin-2 (255-271), human

Product Name Aquaporin-2 (255-271), human Product Quantity 5mg Catalog Number LT1015 Molecular Weight 1821.04 Formula C77H129N25O26 Sequence Gln-Ser-Val-Glu-Leu-His-Ser-Pro-Gln-Ser-Leu-Pro-Arg-Gly-Ser-Lys-Ala Scientific Background Aquaporin-2 (255-2...
$304.56
... more info

Aquaporin-2 (255-271), rat

Product Name Aquaporin-2 (255-271), rat Product Quantity 5mg Catalog Number LT1016 Molecular Weight 1835.07 Formula C78H131N25O26 Sequence Gln-Ser-Val-Glu-Leu-His-Ser-Pro-Gln-Ser-Leu-Pro-Arg-Gly-Thr-Lys-Ala Scientific Background Aquaporin-2 (255-271...
Displaying 621 to 630 (of 2644 Products)