Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 561 to 570 (of 2644 Products)
Price Product Name
$410.00
... more info

Alpha-Tubulin (29-50) Lys40-Acetyl Peptide, Biotinylated

Product Name Alpha-Tubulin (29-50) Lys40-Acetyl Peptide, Biotinylated Product Quantity 1 mg Catalog Number LT9501 Molecular Weight 2918.3 Formula TBD Sequence Ac-GIQPDGQMPSD-K(ac)-TIGGGDDSFNWG-K(biotin) Purity ≥95% Scientific Background This...
$80.00
... more info

alpha9-Gliadin (57-68)

Catalog Number LT9387 Product Name alpha9-Gliadin (57-68) Product Quantity 1 mg Sequence QLQPFPQPQLPY Molecular Weight 1455.8 Purity ≥95% Scientific Background α9-Gliadin(57-68) is an immunodominant gluten-derived epitope...
$272.16
... more info

Alternate Syntide

Product Name Alternate Syntide Product Quantity 5mg Catalog Number LT0937 Molecular Weight 1425.7 Formula C63H112N18O19 Sequence Pro-Leu-Ser-Arg-Thr-Leu-Ser-Val-Ser-Ser-Leu-Pro-Gly-Leu-NH2 Scientific Background Alternate Syntide is a 14-residue...
$220.32
... more info

Alytesin

Product Name Alytesin Product Quantity 10mg Catalog Number LT0938 Molecular Weight 1535.8 Formula C68H106N22O17S Sequence Pyr-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2 Scientific Background Alytesin is a 13-residue synthetic peptide...
$81.00
... more info

AMARA Peptide, AMPK Substrate

Catalog Number LT8896 Product Name AMARA Peptide, AMPK Substrate Product Quantity 1 mg Sequence AMARAASAAALARRR Molecular Weight 1542.9 Formula C62H115N27O17S Purity ≥95% Scientific Background AMARAASAAALARRR is a minimal serine-containing...
$610.00
... more info

Aminopeptidase N/CD13 NGR Peptide, Cyclic CNGRCG

Catalog Number LT8745 Product Name Aminopeptidase N/CD13 NGR Peptide, Cyclic CNGRCG Product Quantity 5 mg Sequence CNGRCG; disulfide bridge Cys1-Cys5 Molecular Weight 606.7 Formula C20H36N10O8S2 Scientific Background Cyclic CNGRCG is an NGR-mo...
$245.00
... more info

AMPK Substrate SAMS Peptide

Catalog Number LT9494 Product Name AMPK Substrate SAMS Peptide Product Quantity 1 mg Sequence HMRSAMSGLHLVKRR Purity ≥95% Scientific Background The SAMS peptide is a classic synthetic substrate for AMP-activated protein kinase. It is widely...
$469.00
... more info

Amylin (8-37), Human

Catalog Number LT9305 Product Name Amylin (8-37), Human Product Quantity 1 mg Sequence ATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Human amylin(8-37) lacks the N-terminal disulfide loop and...
$606.00
... more info

Amylin, Human

Catalog Number LT9304 Product Name Amylin, Human Product Quantity 0.1 mg Sequence KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide 2-7) Molecular Weight 3903.3 Purity ≥95% Scientific Background Human amylin, or islet amyloid polypeptide,...
$606.00
... more info

Amylin, Rat

Catalog Number LT9306 Product Name Amylin, Rat Product Quantity 0.1 mg Sequence KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide 2-7) Molecular Weight TBD Purity ≥95% Scientific Background Rat amylin is a species-specific 37-residue...
Displaying 561 to 570 (of 2644 Products)