Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 21 to 30 (of 2644 Products)
Price Product Name
$233.28
... more info

[Ala9] Autocamtide 2; Autocamtide-2-Related Inhibitory Peptide

Product Name [Ala9] Autocamtide 2; Autocamtide-2-Related Inhibitory Peptide Product Quantity 5mg Catalog Number LT0447 Molecular Weight 1497.7 Formula C64H116N22O19 Sequence Lys-Lys-Ala-Leu-Arg-Arg-Gln-Glu-Ala-Val-Asp-Ala-Leu Scientific Background [...
$285.12
... more info

[APLILSR]pPSA

Product Name [APLILSR]pPSA Product Quantity 5mg Catalog Number LT0448 Molecular Weight 1771.12 Formula C80H131N21O22S Sequence Ala-Pro-Leu-Ile-Leu-Ser-Arg-Ile-Val-Gly-Gly-Trp-Glu-Cys-Glu-Lys Scientific Background [APLILSR]pPSA is a 16-residue...
$183.60
... more info

[Arg0] Met-Enkephalin

Product Name [Arg0] Met-Enkephalin Product Quantity 10mg Catalog Number LT0449 Molecular Weight 729.86 Formula C33H47N9O8S Sequence Arg-Tyr-Gly-Gly-Phe-Met Scientific Background [Arg0] Met-Enkephalin is a synthetic research peptide in the...
$738.72
... more info

[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovi

Product Name [Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovi Product Quantity 5mg Catalog Number LT0451 Molecular Weight 3555.1 Formula C157H253N53O42 Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Arg-Gln-Leu-Ala-V...
$667.44
... more info

[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat

Product Name [Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat Product Quantity 5mg Catalog Number LT0450 Molecular Weight 3213.7 Formula C143H226N46O39 Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Arg-Gln-Leu-Ala-Val-Ar...
$356.40
... more info

[Arg3,14]CTX IV (3-14)

Product Name [Arg3,14]CTX IV (3-14) Product Quantity 5mg Catalog Number LT0453 Molecular Weight 1582.91 Formula C74H119N25O14 Sequence Arg-Asn-Arg-Leu-Ile-Pro-Pro-Phe-Trp-Lys-Thr-Arg-NH2 Scientific Background [Arg3,14]CTX IV (3-14) is a 12-residue...
$213.84
... more info

[Arg3] Substance P

Product Name [Arg3] Substance P Product Quantity 5mg Catalog Number LT0454 Molecular Weight 1375.67 Formula C63H98N20O13S Sequence Arg-Pro-Arg-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 Scientific Background [Arg3] Substance P is a synthetic research...
$850.00
... more info

[Arg3]-Amyloid Beta-Protein (1-40)

Product Name [Arg3]-Amyloid Beta-Protein (1-40) Product Quantity 5mg Catalog Number LT0455 Molecular Weight 4356.97 Formula C195H300N56O56S Sequence Asp-Ala-Arg-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-S...
$277.00
... more info

[Arg6]-Beta-Amyloid (1-40), England Mutation

Product Name Beta-Amyloid (1-40), H6R England Mutation Catalog Number LT9144 Sequence DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Mutation H6R Molecular Weight 4349.2 Purity ≥95% Mechanism & Biological Significance The English H6R familial...
$712.00
... more info

[Arg6]-Beta-Amyloid (1-42), England Mutation

Catalog Number LT9184 Product Name [Arg6]-Beta-Amyloid (1-42), England Mutation Product Quantity 0.5 mg Sequence DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Mutation H6R Molecular Weight TBD Purity ≥95% Scientific Background The H6R...
Displaying 21 to 30 (of 2644 Products)