Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1591 to 1600 (of 2644 Products)
Price Product Name
$933.12
... more info

HIV-gp41-Antigenic Peptide 5

Product Name HIV-gp41-Antigenic Peptide 5 Product Quantity 5mg Catalog Number LT1623 Molecular Weight 4190.77 Formula C184H282N56O53S2 Sequence Arg-Val-Thr-Ala-Ile-Glu-Lys-Tyr-Leu-Gln-Asp-Gln-Ala-Arg-Leu-Asn-Ser-Trp-Gly-Cys-Ala-Phe-Arg-Gln-Val-Cys-Hi...
$183.60
... more info

HIV-gp41-Fragment

Product Name HIV-gp41-Fragment Product Quantity 10mg Catalog Number LT1624 Molecular Weight 486.57 Formula C21H38N6O7 Sequence Ala-Val-Gly-Ile-Gly-Ala Scientific Background HIV-gp41-Fragment is a synthetic HIV-derived research peptide. Synthetic...
$183.60
... more info

HJ Inhibitor Peptide 2

Product Name HJ Inhibitor Peptide 2 Product Quantity 10mg Catalog Number LT1625 Molecular Weight 964.16 Formula C48H61N13O7S Sequence Lys-Trp-Trp-Cys-Arg-Trp Scientific Background HJ Inhibitor Peptide 2 is a 6-residue synthetic peptide with the...
$424.00
... more info

HNP-1, Human Neutrophil Defensin-1

Catalog Number LT9377 Product Name HNP-1, Human Neutrophil Defensin-1 Product Quantity 0.5 mg Sequence ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide 2-30, 4-19, 9-29) Molecular Weight 3443.1 Purity ≥95% Scientific Background HNP-1 is a...
$356.40
... more info

HPV-E6-C

Product Name HPV-E6-C Product Quantity 5mg Catalog Number LT1626 Molecular Weight 2516.92 Formula C110H178N36O30S Sequence Pro-Leu-Cys-Pro-Glu-Glu-Lys-Gln-Arg-His-Leu-Asp-Lys-Lys-Gln-Arg-Phe-His-Asn-Ile Scientific Background HPV-E6-C is a synthetic...
$479.52
... more info

HPV-E6-M

Product Name HPV-E6-M Product Quantity 5mg Catalog Number LT1627 Molecular Weight 2459.64 Formula C111H151N25O37S Sequence Ser-Glu-Tyr-Pro-His-Tyr-Cys-Tyr-Ser-Leu-Tyr-Gly-Thr-Thr-Leu-Glu-Gln-Gln-Tyr-Asn Scientific Background HPV-E6-M is a synthetic...
$265.68
... more info

HPV-E6-N

Product Name HPV-E6-N Product Quantity 5mg Catalog Number LT1628 Molecular Weight 1810.07 Formula C76H128N24O25S Sequence Asp-Pro-Gln-Glu-Arg-Pro-Arg-Lys-Leu-Pro-Gln-Leu-Cys-Thr-Glu, DPQERPRKLPQLCTE Scientific Background HPV-E6-N is a synthetic...
$479.52
... more info

HPV-E7-C

Product Name HPV-E7-C Product Quantity 5mg Catalog Number LT1629 Molecular Weight 2102.08 Formula C83H128N24O40 Sequence Ser-Ser-Glu-Glu-Glu-Asp-Glu-Ile-Asp-Gly-Pro-Ala-Gly-Gln-Ala-Glu-Pro-Asp-Arg-Ala Scientific Background HPV-E7-C is a synthetic...
$479.52
... more info

HPV-E7-N

Product Name HPV-E7-N Product Quantity 5mg Catalog Number LT1630 Molecular Weight 2467.72 Formula C108H159N23O39S2 Sequence Tyr-Met-Leu-Asp-Leu-Gln-Pro-Glu-Thr-Thr-Asp-Leu-Tyr-Cys-Tyr-Glu-Gln-Leu-Asn-Asp Scientific Background HPV-E7-N is a...
$155.00
... more info

HPV16 E7 (49-57)

Catalog Number LT9415 Product Name HPV16 E7 (49-57) Product Quantity 1 mg Sequence RAHYNIVTF Molecular Weight TBD Purity ≥95% Scientific Background HPV16 E7(49-57) is an H-2Db-restricted tumor/viral epitope derived from the E7...
Displaying 1591 to 1600 (of 2644 Products)