Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2341 to 2350 (of 2783 Products)
Price Product Name
$350.00
... more info

Poly-L-Lysine, KKKKKKKKKKKK, K12

Product Name Poly-L-Lysine, KKKKKKKKKKKK, K12 Product Quantity 5 mg Catalog Number LT8307 Molecular Weight 1556.10 Formula C72H146N24O13 Sequence Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys, KKKKKKKKKKKK Purity >95% Related Products K10...
$380.00
... more info

Polylysine, Poly-L-Lysine, K20

Product Name Polylysine, Poly-L-Lysine, K20 Product Quantity 5mg, >95% Catalog Number LT8285 Molecular Weight 2581.496 Formula C120H242O21N40 Sequence Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys,...
$302.40 $150.00Save: 50% off
... more info

Polylysine, Poly-L-Lysine, KKKKKKKKKK, K10

Product Name Polylysine, Poly-L-Lysine, KKKKKKKKKK, K10 Product Quantity 5mg, >95% Catalog Number LT2069 Molecular Weight 1299.77 Formula C60H122N20O11 Sequence Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys, KKKKKKKKKK Related Products K10 Peptide K12...
$233.28
... more info

pp60 c-src (521-533)

Product Name pp60 c-src (521-533) Product Quantity 5mg Catalog Number LT2070 Molecular Weight 1463.5 Formula C62H94N16O25 Sequence Thr-Ser-Thr-Glu-Pro-Gln-Tyr-Gln-Pro-Gly-Glu-Asn-Leu Scientific Background pp60 c-src (521-533) is a synthetic...
$324.00
... more info

pp60 C-SRC Carboxy-Terminal Phosphoregulatory Peptide Phosphoryl

Product Name pp60 C-SRC Carboxy-Terminal Phosphoregulatory Peptide Phosphoryl Product Quantity 5mg Catalog Number LT2071 Molecular Weight 1543.53 Formula C62H95N16O28P Sequence Thr-Ser-Thr-Glu-Pro-Gln-pTyr-Gln-Pro-Gly-Glu-Asn-Leu Scientific...
$131.00
... more info

pp60(v-SRC) Autophosphorylation Site, Phosphorylated

Catalog Number LT8915 Product Name pp60(v-SRC) Autophosphorylation Site, Phosphorylated Product Quantity 1 mg Sequence RRLIEDNE-pY-TARG Molecular Weight 1672.8 Formula C66H110N23O26P Purity ≥95% Scientific Background RRLIEDNE-pY-TARG is a...
$233.28
... more info

pp60(v-SRC) Autophosphorylation Site,Protein Tyrosine Kinase Sub

Product Name pp60(v-SRC) Autophosphorylation Site,Protein Tyrosine Kinase Sub Product Quantity 5mg Catalog Number LT2072 Molecular Weight 1592.74 Formula C66H109N23O23 Sequence Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly Scientific...
$233.28
... more info

pp60(v-SRC) Autophosphorylation Site,Tyrosine Phosphopeptide

Product Name pp60(v-SRC) Autophosphorylation Site, Tyrosine Phosphopeptide Product Quantity 5mg Catalog Number LT2073 Molecular Weight 1672.74 Formula C66H110N23O27P Sequence Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-pTyr-Thr-Ala-Arg-Gly Scientific Background...
$606.00
... more info

Pramlintide

Catalog Number LT9307 Product Name Pramlintide Product Quantity 0.1 mg Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide 2-7) Molecular Weight 3949.4 Purity ≥95% Scientific Background Pramlintide is a three-proline analog of human...
$375.84
... more info

Pre-S1 (12-32)

Product Name Pre-S1 (12-32) Product Quantity 5mg Catalog Number LT2091 Molecular Weight 2296.61 Formula C104H154N26O31S Sequence Met-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro Scientific Background Pre-S1...
Displaying 2341 to 2350 (of 2783 Products)