Pancreastatin (24-52), Human, Amide

PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 is the 29-residue C-terminal active human pancreastatin peptide, commonly designated human pancreastatin (24-52) or hPST29. Pancreastatin is generated from chromogranin A and has been studied as a dysglycemic regulatory peptide in glucose and insulin homeostasis. Published work using this exact amidated sequence reports inhibition of insulin-stimulated glucose uptake in adipocytes and supports its use in studies of pancreastatin signaling, metabolism and chromogranin A-derived peptide biology.

• pancreastatin signaling studies
• glucose and insulin homeostasis research
• chromogranin A peptide biology
• metabolic peptide structure-function studies

This 29-residue amidated peptide is a defined active human pancreastatin fragment and should be distinguished from the longer 52-residue pancreastatin sequence described in some literature. Biological responses depend on model, concentration and exposure conditions.

1. Pancreastatin is an endogenous peptide that regulates glucose homeostasis
2. Naturally Occurring Variants of the Dysglycemic Peptide Pancreastatin
3. Pancreastatin induces islet amyloid peptide aggregation in the pancreas, liver, and skeletal muscle