Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2251 to 2260 (of 2783 Products)
Price Product Name
$751.00
... more info

Parathyroid Hormone (1-34)-Lys(Biotin), Human

Catalog Number LT9335 Product Name Parathyroid Hormone (1-34)-Lys(Biotin), Human Product Quantity 1 mg Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin) Molecular Weight 4472.5 Purity ≥95% Scientific Background This PTH(1-34)...
$182.00
... more info

Parathyroid Hormone (1-34), Human

Catalog Number LT9333 Product Name Parathyroid Hormone (1-34), Human Product Quantity 1 mg Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Molecular Weight 4118.0 Purity ≥95% Scientific Background Human PTH(1-34) is the biologically active...
$344.00
... more info

Parathyroid Hormone (1-34), Human, Biotinylated

Catalog Number LT9334 Product Name Parathyroid Hormone (1-34), Human, Biotinylated Product Quantity 1 mg Sequence Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Molecular Weight 4344.3 Purity ≥95% Scientific Background N-terminally...
$810.00
... more info

Parathyroid Hormone (1-34),human

Product Name Parathyroid Hormone (1-34), human Product Quantity 5mg Catalog Number LT2018 Molecular Weight 4117.8 Formula C181H291N55O51S2 Sequence...
$810.00
... more info

Parathyroid Hormone (1-34),rat

Product Name Parathyroid Hormone (1-34), rat Product Quantity 5mg Catalog Number LT2019 Molecular Weight 4057.8 Formula C180H291N55O48S2 Sequence...
$680.40
... more info

Parathyroid Hormone (1-38),human

Product Name Parathyroid Hormone (1-38), human Product Quantity 5mg Catalog Number LT2021 Molecular Weight 4458.2 Formula C197H319N59O55S2 Sequence...
$790.56
... more info

Parathyroid Hormone (1-44),human

Product Name Parathyroid Hormone (1-44), human Product Quantity 5mg Catalog Number LT2022 Molecular Weight 5063.93 Formula C225H366N68O61S2 Sequence...
$265.68
... more info

Parathyroid Hormone (70-84),human

Product Name Parathyroid Hormone (70-84), human Product Quantity 5mg Catalog Number LT2023 Molecular Weight 1587.79 Formula C67H118N20O24 Sequence Ala-Asp-Lys-Ala-Asp-Val-Asn-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln Scientific Background Parathyroid Hormone...
$810.00
... more info

Parathyroïd Hormone(1-34),bovine

Product Name Parathyroïd Hormone(1-34),bovine Product Quantity 5mg Catalog Number LT2024 Molecular Weight 4108.7 Formula C183H288N54O50S2 Sequence...
$270.00
... more info

PB1(703 - 711), Influenza

Product Name PB1(703 - 711), Influenza Product Quantity 10mg Catalog Number LT2025 Molecular Weight 1034.19 Formula C45H75N15O13 Sequence Ser-Ser-Tyr-Arg-Arg-Pro-Val-Gly-Ile Scientific Background PB1(703 - 711), Influenza is a synthetic influenza...
Displaying 2251 to 2260 (of 2783 Products)