My Account Information
Displaying 131 to 140 (of 7696 Products)
| Price | Product Name |
|---|---|
$1,200.00 ... more info |
Product Name (KFF)3K-PNA:KFFKFFKFFK-CTCATACTCTProduct Quantity 125nmolCatalog Number LT8195 Purity >95% Sequence KFFKFFKFFK-{CTCATACTCT}-NH2 Description The acpP-targeting antisense PNA CTCATACTCT, particularly when linked to the cell... |
$280.00 ... more info |
Catalog Number: LT8163 Category: Peptide Sequence:Low Molecular Weight Protamine (LMWP): VSRRRRRRGGRRRR Modifications: Low Molecular Weight Protamine (LMWP), with the sequence VSRRRRRRGGRRRR, is a peptide derived from protamine, a naturally... |
$350.00 ... more info |
Catalog Number: LT8227 Category: Peptide Sequence: Cy3-GISYGRKKRRQRRRAHQ, HIV TAT (48-60) variant from the core sequence GRKKRRQRRRPPQ Modifications: This is a cy3 labeled cell-penetrating peptides (CPPs) derived from the human... |
$350.00 $99.00Save: 72% off ... more info |
Corticotropin Releasing Factor, human, rat [86784-80-7] Catalog Number: LT8173 Category: Peptide Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, amidation Chemistry : Sequence:... |
$350.00 $99.00Save: 72% off ... more info |
Catalog Number: LT8172 Category: Peptide Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, amidation Chemistry : Sequence: NH2- His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala -... |
$350.00 $99.00Save: 72% off ... more info |
Catalog Number: LT8171 Category: Peptide Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, amidation Chemistry : Sequence:... |
$262.00 ... more info |
HIV-1 tat Protein TAT (47-57)-Cys, TAT-Cys C-term Product Name HIV-1 tat Protein TAT (47-57)-Cys, TAT-Cys C-termProduct Quantity5mg Product Description This is the most characterized fragment of the HIV transactivator protein (TAT) YGRKKRRQRRR. This arginine-rich TAT peptide penetrates the plasma... |
$650.00 ... more info |
Biotinylated Human KRAS G12V (HLA-A*02:01) Protein (LTP10000) Product NameBiotinylated Human KRAS G12V (HLA-A*02:01) Protein (LTP10000) Catalog NumberLTP10000 Quantity100ug Price $ 650 In stock BackgroundKirsten rat sarcoma 2 viral oncogene homolog (KRAS) is the most commonly mutated oncogene in human... |
$890.00 ... more info |
Product Name HS-cR10 Product Quantity 5 mg Purity >95% Catalog Number LT8154 Molecular Weight C86H168N47O20S [M + H]+, 2213; [M + 2H]2+,1107; found, 1108 Formula C86H168N47O20S Sequence C-(mini-PEG)-(mini-PEG)-KRrRrRrRrRrE, C-Terminal:... |
$598.80 $299.00Save: 50% off ... more info |
Product NameEcoPNA1169Product Quantity 125nmolCatalog Number LT-PNA003 Purity >95% Sequence Biotin - {CAACACACAGTGTC} Description This Nucleic Acid Mimics (NAMs) sequence 5'-CAA CAC ACA GTG TC-3' hybridizes between positions 1169 and 1183 of... |
Displaying 131 to 140 (of 7696 Products)