My Account Information

Displaying 141 to 150 (of 7701 Products)
Price Product Name
$350.00 $99.00Save: 72% off
... more info

Corticotropin Releasing Factor, human, rat [86784-80-7]

Catalog Number: LT8173 Category: Peptide Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, amidation Chemistry : Sequence:...
$350.00 $99.00Save: 72% off
... more info

Exenatide Acetate (Exendin-4)

Catalog Number: LT8172 Category: Peptide Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, amidation Chemistry : Sequence: NH2- His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala -...
$350.00 $99.00Save: 72% off
... more info

Peptide YY (3-36), human

Catalog Number: LT8171 Category: Peptide Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, amidation Chemistry : Sequence:...
$262.00
... more info

HIV-1 tat Protein TAT (47-57)-Cys, TAT-Cys C-term

Product Name HIV-1 tat Protein TAT (47-57)-Cys, TAT-Cys C-termProduct Quantity5mg Product Description This is the most characterized fragment of the HIV transactivator protein (TAT) YGRKKRRQRRR. This arginine-rich TAT peptide penetrates the plasma...
$650.00
... more info

Biotinylated Human KRAS G12V (HLA-A*02:01) Protein (LTP10000)

Product NameBiotinylated Human KRAS G12V (HLA-A*02:01) Protein (LTP10000) Catalog NumberLTP10000 Quantity100ug Price $ 650 In stock BackgroundKirsten rat sarcoma 2 viral oncogene homolog (KRAS) is the most commonly mutated oncogene in human...
$890.00
... more info

HS-cR10

Product Name HS-cR10 Product Quantity 5 mg Purity >95% Catalog Number LT8154 Molecular Weight C86H168N47O20S [M + H]+, 2213; [M + 2H]2+,1107; found, 1108 Formula C86H168N47O20S Sequence C-(mini-PEG)-(mini-PEG)-KRrRrRrRrRrE, C-Terminal:...
$598.80 $299.00Save: 50% off
... more info

EcoPNA1169

Product NameEcoPNA1169Product Quantity 125nmolCatalog Number LT-PNA003 Purity >95% Sequence Biotin - {CAACACACAGTGTC} Description This Nucleic Acid Mimics (NAMs) sequence 5'-CAA CAC ACA GTG TC-3' hybridizes between positions 1169 and 1183 of...
$280.00
... more info

mUNO-CSPGAK

Catalog Number: 5674-02 Category: mUNO Peptide Sequence: H-CSPGAK-OH Description: UNO selectively targets Mannose Receptor (CD206/MRC1)-expressing Tumor-Associated Macrophages (TAMs), contributing to the suppression of tumor growth,...
$150.00
... more info

Neuropeptide Y

Product Name: Neuropeptide Y (human, rat) Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (Modifications: Tyr-36 = C-terminal amide) Product Quantity: 1 mg, 5mg, 10mg Purity: >95% Catalog Number: LT2670 CAS Number:  90880-35-6 Molecular...
$2,500.00
... more info

SARS-CoV2 Omicron XBB.1.5 variant specific RBD/NTD-peptide library

SARS-CoV2 Omicron XBB.1.5 variant specific RBD/NTD-peptide library : The current XBB variant of SARS-CoV-2 with the strongest immune escaping properties is currently the most dominant variant circulating around the world. It is highly required to...
Displaying 141 to 150 (of 7701 Products)