Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2961 to 2970 (of 3012 Products)
Price Product Name
$310.00
... more info

VAMP2 N-Terminal Residues 1-18 Peptide

Catalog Number LT9633 Product Name VAMP2 N-Terminal Residues 1-18 Peptide Sequence MSATAATVPPAAPAGEGG Product Quantity 4 mg Purity ≥95% Molecular Weight 1555.72 Formula C65H106N18O24S Scientific Overview Vesicle-associated membrane protein 2...
$382.32
... more info

Vanilloid Receptor Subtype 1 (VR1)

Product Name Vanilloid Receptor Subtype 1 (VR1) Product Quantity 5mg Catalog Number LT2358 Molecular Weight 1783 Formula C75H117N18O28S2 Sequence Cys-Glu-Asp-Ala-Glu-Val-Phe-Lys-Asp-Ser-Met-Val-Pro-Gly-Glu-Lys Scientific Background Vanilloid...
$375.84
... more info

Vasoactive Intestinal Constractor [VIC]; Endophilin Beta, Mouse

Product Name Vasoactive Intestinal Constractor [VIC]; Endophilin Beta, Mouse Product Quantity 5mg Catalog Number LT2359 Molecular Weight 2574 Formula C116H161N27O32S4 Sequence Cys-Ser-Cys-Asn-Ser-Trp-Leu-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Il...
$1,017.36
... more info

Vasoactive Intestinal Contractor [VIC]

Product Name Vasoactive Intestinal Contractor [VIC] Product Quantity 5mg Catalog Number LT2360 Molecular Weight 2573.99 Formula C116H161N27O32S4 Sequence Cys-Ser-Cys-Asn-Ser-Trp-Leu-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp(Disulfide...
$518.40
... more info

Vasoactive Intestinal peptide

Product Name Vasoactive Intestinal peptide Product Quantity 5mg Catalog Number LT2361 Molecular Weight 3325.7 Formula C147H238N44O42S1 Sequence His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Le...
$439.00
... more info

Vasoactive Intestinal Peptide (VIP), Human

Catalog Number LT9314 Product Name Vasoactive Intestinal Peptide (VIP), Human Product Quantity 1 mg Sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 Molecular Weight 3325.8 Purity ≥95% Scientific Background VIP is a 28-residue amidated neuropeptide...
$622.08
... more info

Vasonatrin Peptide (VNP)

Product Name Vasonatrin Peptide (VNP) Product Quantity 5mg Catalog Number LT2362 Molecular Weight 2865.37 Formula C124H198N36O36S3 Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr ((...
$280.00
... more info

VCP Residues 792-806 Peptide

Catalog Number LT9570 Product Name VCP Residues 792-806 Peptide Sequence CGGSVYTEDNDDDLYG Product Quantity 4 mg Purity ≥95% Molecular Weight 1722.71 Formula C70H99N17O32S Scientific Overview Mouse valosin-containing protein C-terminal peptide...
$250.00
... more info

VDAC1 Residues 185-197 Peptide

Catalog Number LT9526 Product Name VDAC1 Residues 185-197 Peptide Sequence CNDGTEFGGSIYQK Product Quantity 4 mg Purity ≥95% Molecular Weight 1518.62 Formula C64H95N17O24S Scientific Overview Human voltage-dependent anion channel 1 peptide...
$567.00
... more info

VEGFR2 pTyr1175 Peptide

Catalog Number LT9485 Product Name VEGFR2 pTyr1175 Peptide Product Quantity 1 mg Sequence DNDpYIVLPISETLSMEEDSGLSLPTSPVSCMEEE Purity ≥95% Scientific Background VEGFR2 pTyr1175 recruits downstream signaling proteins including PLC-gamma and is...
Displaying 2961 to 2970 (of 3012 Products)