Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2161 to 2170 (of 2783 Products)
Price Product Name
$265.68
... more info

OV - 2, Sheep

Product Name OV - 2, Sheep Product Quantity 5mg Catalog Number LT1956 Molecular Weight 1799.39 Formula C84H159N29O14 Sequence Leu-Arg-Arg-Ile-Ile-Arg-Lys-Ile-Ile-His-Ile-Ile-Lys-Lys-NH2 Scientific Background OV - 2, Sheep is a 14-residue synthetic...
$238.00
... more info

OVA (241-270) Ovalbumin Peptide

Catalog Number LT8859 Product Name OVA (241-270) Ovalbumin Peptide Product Quantity 1 mg Sequence SMLVLLPDEVSGLEQLESIINFEKLTEWTS Molecular Weight 3422.1 Formula C154H246N34O51S Purity ≥95% Scientific Background SMLVLLPDEVSGLEQLESIINFEKLTEWTS...
$80.00
... more info

OVA (257-264) SIINFEKL Peptide

Catalog Number LT8990 Product Name OVA (257-264) SIINFEKL Peptide Product Quantity 1 mg Sequence SIINFEKL CAS Number 138831-86-4 Molecular Weight 963.2 Formula C45H74N10O13 Purity ≥95% Scientific Background SIINFEKL is the canonical...
$261.00
... more info

OVA (257-264), 5-FAM-Labeled

Catalog Number LT8980 Product Name OVA (257-264), 5-FAM-Labeled Product Quantity 1 mg Sequence 5-FAM-SIINFEKL-NH2 Molecular Weight 1320.5 Formula C66H85N11O18 Purity ≥95% Scientific Background 5-FAM-SIINFEKL-NH2 is a fluorescent derivative of...
$382.00
... more info

OVA (257-264), C-Terminal Amide

Catalog Number LT8991 Product Name OVA (257-264), C-Terminal Amide Product Quantity 5 mg Sequence SIINFEKL-NH2 Molecular Weight 962.2 Formula C45H74N10O13 Purity ≥95% Scientific Background SIINFEKL-NH2 is a C-terminally amidated form of the...
$92.00
... more info

OVA (257-264), Scrambled Control

Catalog Number LT8986 Product Name OVA (257-264), Scrambled Control Product Quantity 1 mg Sequence FILKSINE Molecular Weight 963.2 Formula C45H74N10O13 Purity ≥95% Scientific Background FILKSINE is a sequence-scrambled control derived from...
$108.00
... more info

OVA (323-339) Class II Epitope

Catalog Number LT8992 Product Name OVA (323-339) Class II Epitope Product Quantity 1 mg Sequence ISQAVHAAHAEINEAGR CAS Number 92915-79-2 Molecular Weight 1774.1 Formula C74H120N26O25 Purity ≥95% Scientific Background ISQAVHAAHAEINEAGR is the...
$328.00
... more info

OVA (323-339), 5-TAMRA-Labeled

Catalog Number LT8975 Product Name OVA (323-339), 5-TAMRA-Labeled Product Quantity 1 mg Sequence 5-TAMRA-ISQAVHAAHAEINEAGR Molecular Weight 2186.5 Formula C99H140N28O29 Purity ≥95% Scientific Background OVA(323-339) is a classic...
$177.00
... more info

OVA (323-339), Biotin-Labeled

Catalog Number LT8987 Product Name OVA (323-339), Biotin-Labeled Product Quantity 1 mg Sequence Biotin-ISQAVHAAHAEINEAGR Molecular Weight 2000.4 Formula C84H134N28O27S Purity ≥95% Scientific Background Biotin-ISQAVHAAHAEINEAGR is an...
$92.00
... more info

OVA (323-339), C-Terminal Amide

Catalog Number LT8993 Product Name OVA (323-339), C-Terminal Amide Product Quantity 1 mg Sequence ISQAVHAAHAEINEAGR-NH2 Molecular Weight 1773.1 Formula C74H121N27O24 Purity ≥95% Scientific Background ISQAVHAAHAEINEAGR-NH2 is the amidated form...
Displaying 2161 to 2170 (of 2783 Products)