Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2061 to 2070 (of 2783 Products)
Price Product Name
$2,449.44
... more info

Nesfatin-1 (rat)

Product Name Nesfatin-1 (rat) Product Quantity 5mg Catalog Number LT1872 Molecular Weight 9582.8 Formula C424H684N116O136 Sequence...
$1,975.00
... more info

Nesfatin-1, Human

Catalog Number LT9272 Product Name Nesfatin-1, Human Product Quantity 0.1 mg Sequence VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL Molecular Weight TBD Purity ≥95% Scientific Background Nesfatin-1 is an...
$285.12
... more info

Neurogranin (28-43)

Product Name Neurogranin (28-43) Product Quantity 5mg Catalog Number LT1874 Molecular Weight 1800.18 Formula C78H134N28O19S Sequence Ala-Ala-Lys-Ile-Gln-Ala-Ser-Phe-Arg-Gly-His-Met-Ala-Arg-Lys-Lys Scientific Background Neurogranin (28-43) is a...
$751.00
... more info

Neurogranin (28-43), Biotin-LC, PKC Substrate

Catalog Number LT8897 Product Name Neurogranin (28-43), Biotin-LC, PKC Substrate Product Quantity 5 mg Sequence Biotin-LC-AAKIQASFRGHMARKK Molecular Weight 2139.7 Formula C94H159N31O20S2 Purity ≥95% Scientific Background ...
$411.00
... more info

Neurogranin (48-76), human

Catalog Number LT9186 Product Name Neurogranin (48-76), human Product Quantity 1 mg Sequence SGERGRKGPGPGGPGGAGVARGGAGGGPS-OH Molecular Weight 2417.8 Purity ≥95% Scientific Background Neurogranin is a postsynaptic calmodulin-binding...
$170.00
... more info

Neurokinin A

Catalog Number LT9258 Product Name Neurokinin A Product Quantity 1 mg Sequence HKTDSFVGLM-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Neurokinin A is a tachykinin neuropeptide encoded by TAC1 and preferentially activates the...
$250.00
... more info

Neurokinin A (4-10)

Product Name Neurokinin A (4-10) Product Quantity 5 mg Catalog Number LT1875 Molecular Weight 766.92 Formula C34H54N8O10S1 Sequence Asp-Ser-Phe-Val-Gly-Leu-Met-NH2, DSFVGLM Related Product Neurokinin A: HKTDSFVGLM Neurokinin A (4-10): DSFVGLM...
$250.00 $195.00Save: 22% off
... more info

Neurokinin A; Substance K; Neuromedin L; NKA

Product Name Neurokinin A; Substance K; Neuromedin L; NKA Product Quantity 5mg Catalog Number LT1876 Molecular Weight 1133.34 Formula C50H80N14O14S Sequence HKTDSFVGLM, His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 Cas# 86933-74-6 Related Product ...
$250.00
... more info

Neurokinin B

Product Name Neurokinin B Product Quantity 5mg Catalog Number LT1877 Molecular Weight 1210.45 Formula C55H79N13O14S2 Sequence Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 Related Product Neurokinin A: HKTDSFVGLM Neurokinin A (4-10): DSFVGLM...
$170.00
... more info

Neurokinin B

Catalog Number LT9259 Product Name Neurokinin B Product Quantity 1 mg Sequence DMHDFFVGLM-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Neurokinin B is a TAC3-derived tachykinin and endogenous NK3-receptor ligand. It has major...
Displaying 2061 to 2070 (of 2783 Products)