My Account Information
Displaying 1 to 10 (of 7707 Products)
| Price | Product Name |
|---|---|
$1,150.00 $999.00Save: 13% off ... more info |
Sortase Labeling Starter Kit All-in-one solution for Sortase A-mediated biotin labeling and flow cytometry detection Build a complete LPETG / Sortase A workflow with substrate, enzyme, and fluorescent detection—optimized for LIPSTIC assays ,... |
$350.00 $299.00Save: 15% off ... more info |
Anti-Biotin Rabbit Monoclonal Antibody (PE Conjugate) High-sensitivity detection of biotinylated LPETG substrates in Sortase A-mediated labeling systems Product Overview The Anti-Biotin Rabbit Monoclonal Antibody (PE conjugated) is designed for... |
$380.00 ... more info |
Human Intracellular Sigma Peptide Product Name TAT-ISP Peptide, GRKKRRQRRRCDMAEHTERLKANDSLKLSQEYESI Product Quantity 4 mg Purity >95% Catalog Number LT8310 Sequence GRKKRRQRRRCDMAEHTERLKANDSLKLSQEYESI Product Description The peptide... |
$450.00 ... more info |
Catalog Number: LT8309 Category: self-peptide Sequence: Lys(N3)-GNYTCEVTELTREGETIIELK, CD47-derived peptide , Options to conjugate with DSPE-PEG-DBCO, MW 1,000, MW 2,000, or MW 3,400. Please quote for the conjugation service. Quantity: 4 mg ... |
$250.00 ... more info |
Product Name M9M Peptide, GGSYNDFGNYNNQSSNFGPMKGGNFGGRFEPYANPTKR Catalog Number LT8306 Quantity 1 mg Purity >95% Molecular Weight 4148.42 Formula C181H256N54O58S Sequence GGSYNDFGNYNNQSSNFGPMKGGNFGGRFEPYANPTKR Product... |
$350.00 ... more info |
Poly-L-Lysine, KKKKKKKKKKKK, K12 Product Name Polylysine, Poly-L-Lysine, KKKKKKKKKKKK, K12 Product Quantity 5 mg Purity >95% Catalog Number LT8307 Molecular Weight 1556.10 Formula C72H146N24O13 Sequence Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys,... |
$450.00 ... more info |
Product Name FITC-Ahx-CD47 Peptide, FITC-Ahx-GNYTCEVTELSREGKTVIELK Product Quantity 4 mg Purity >95% Catalog Number LT8308 Modification N-terminal FITC label with aminohexanoic acid (Ahx) linker Sequence ... |
$380.00 ... more info |
Product Name Ghrelin (human) Product Quantity 4 mg, >95% purity Catalog Number LT8305 Molecular Weight 3088.53 Formula C135H223N43O40 Sequence GSSFLSPEHQRVQQRKESKKPPAKLQP, Gly - Ser - Ser - Phe - Leu - Ser - Pro - Glu -... |
$450.00 ... more info |
Catalog Number:LT8304 Packing Details: 5mg Physical Appearance:Freeze-dried powder Mol. Wt.:1815.08 g/mol Sequence:YLRIVQCRSVEGSCGF, Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe, 7-14 disulfide bond. Related products: Linear HGH... |
$450.00 ... more info |
Product Name RALA Peptide, WEARLARALARALARHLARALARALRACEA, Related product: KALA peptide Product Quantity 4 mg Purity >95% Catalog Number LT8303 Molecular Weight 2872.4 Formula Sequence ... |
Displaying 1 to 10 (of 7707 Products)
