My Account Information

Displaying 4361 to 4370 (of 7697 Products)
Price Product Name
$960.00
... more info

S961-GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY

United States Patent Application 20210018520: COMPOSITIONS FOR AND METHODS OF DIAGNOSING, PROGNOSING, AND TREATING DIABETES LifeTein synthesized the S961 peptides. S961 is a biosynthetic insulin receptor antagonist that inhibits cell proliferation...
$650.00 $220.00Save: 66% off
... more info

Dabcyl-KTSAVLQSGFRKME-Edans

Catalog #: LT483449 Sequence: {DABCYL}-KTSAVLQSGFRKM-E(EDANS) Molecular Formula: C95H141N25O24S2 Molecular Weight: 2081.39 Quantity: 5mg Purity: >95% CAS Registry #: 730985-86-1 Dabcyl-KTSAVLQSGFRKME-Edans : Dabcyl-KTSAVLQSGFRKME-Edans, TFA,...
$300.00
... more info

NLVPMVATV CMV pp65 (495 - 503)

Product NameCEF20, Cytomegalovirus, CMV pp65 (495 - 503), NLVPMVATV Product Quantity 5 mg, >97% Purity by HPLC Product DescriptionAntigen Peptide CMV pp65 is HLA-A*0201-restricted epitope from Cytomegalovirus pp65 (495-503). Human...
... more info

Monoclonal Antibodies to Coronavirus SARS-CoV-2 RBD Domain

Catalog Number : LTA-V010-1MG Name : SARS-CoV-2 Spike RBD Monoclonal Antibody Immunogens : Utilizes 2019 novel Coronavirus spike protein receptor binding domain as the immunogens for monoclonal antibody production Antibody Subtype : IgG1...
... more info

SARS-CoV-2 B.1.617 Variant (India) Spike RBD (L452R/E484Q) Mutan

Description :SARS-CoV-2 B.1.617 Variant (India) Spike RBD (L452R/E484Q) Mutant Protein                                         Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe acute...
$800.00
... more info

Recombinant Human Transmembrane protease serine 2 TMPRSS2

Featured Product New! : Monoclonal Antibodies to Coronavirus SARS-CoV-2 RBD Domain Description :Recombinant Human Transmembrane protease serine 2 (TMPRSS2) Protein                                         Product : Recombinant...
... more info

Recombinant SARS-CoV-2 Spike NTD Protein

Featured Product New! : Monoclonal Antibodies to Coronavirus SARS-CoV-2 RBD Domain Description :Recombinant SARS-CoV-2 Spike NTD Protein                                         Product : Recombinant protein of severe acute...
$598.80
... more info

Peptide Library: SARS-CoV-2 Receptor Binding Domain, 4 Fragments

Featured Product New! : Monoclonal Antibodies to Coronavirus SARS-CoV-2 RBD Domain Overlapping Peptide Library : The SARS-CoV-2 Receptor Binding Domain is divided in to 4 fragments of 20 amino acids per peptide. The resulting overlapping peptide...
$2,376.00 $1,386.00Save: 42% off
... more info

Peptide Library: SARS-CoV-2 Receptor Binding Domains

Featured Product New! : Monoclonal Antibodies to Coronavirus SARS-CoV-2 RBD Domain Overlapping Peptide Library : The SARS-CoV-2 Receptor Binding Domain is divided in to several fragments (15 amino acids) that overlap (5 amino acids). The resulting...
... more info

Monobodies Against 2019 Coronavirus SARS-CoV-2 Spike RBD Protein

Assay principle : Utilizes pairs of antibodies to capture and detect targets quickly Advantages : Eliminates the needs for animals; Affinity and specificity can be engineered; Permits subtraction of common epitopes Progress Update : Monoclonal ELISA...
Displaying 4361 to 4370 (of 7697 Products)