My Account Information
Displaying 881 to 890 (of 7696 Products)
| Price | Product Name |
|---|---|
$380.00 ... more info |
Biotin-Ahx-KANNAVKNNNNEEPSDKHIEQYLKTIQNSL Catalog Number: 6236 Category: Peptide Sequence: Biotin-Ahx-KANNAVKNNNNEEPSDKHIEQYLKTIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-KANNAVKNNNNEEPSDKHIKEYLNKIQNSL Catalog Number: 6244 Category: Peptide Sequence: Biotin-Ahx-KANNAVKNNNNEEPSDKHIKEYLNKIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Product Name:Biotin-Ahx-LPETG-NH2 Catalog Number: 6148 Sequence: Biotin-Ahx-LPETG-NH2 Description: Biotin, Ahx linker, amidation; The majority of Staphylococcus aureus virulence- and colonization-associated surface proteins contain a... |
| ... more info | Catalog Number: 5467 Category: Peptide Sequence: Biotin-Ahx-LPETGS-NH2, Biotin–aminohexanoic acid–LPETGS (C-terminal amide) How to dissolve Biotin-LPETGS? More information about Biotin-Ahx-LPETGS-NH2 Quantity: 5 mg, 100 mg, 1 gram ... |
$280.00 ... more info |
Catalog Number: 6142 Category: Peptide Sequence: Biotin-Ahx-LPETGS-COOH, Check the original amidated version here. Modifications: Biotin, Ahx linker, free acid; The majority of Staphylococcus aureus virulence- and colonization-associated... |
| ... more info | Catalog Number: 5467 Category: Peptide Sequence: Biotin-Ahx-LPETGS-NH2, Biotin–aminohexanoic acid–LPETGS (C-terminal amide) How to dissolve Biotin-LPETGS? More information about Biotin-Ahx-LPETGS-NH2 Quantity: 5 mg, 100 mg, 1 gram ... |
$280.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDKHIEKYLKEIQNSL Catalog Number: 6240 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDKHIEKYLKEIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$420.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDKHIEQYLKTIKNSL Catalog Number: 6238 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDKHIEQYLKTIKNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$420.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDKHIEQYLNKIKNSI Catalog Number: 6239 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDKHIEQYLNKIKNSI Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDKHITEYLKKIKNSI Catalog Number: 6243 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDKHITEYLKKIKNSI Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 881 to 890 (of 7696 Products)
