Biotin-Ahx-NANNAVKNNNNEEPSDKHIEKYLKEIQNSL

$560.00

Catalog Number:
6240
Category:
Peptide
Sequence:
Biotin-Ahx-NANNAVKNNNNEEPSDKHIEKYLKEIQNSL
Modifications:
Quantity:
10mg
Purity:
96.57 %
Notes:

Add to Cart:

  • 1 Units in Stock

Copyright © 2022 LifeTein.com. Powered by LifeTein