Scientific Background | Biotin-Ahx-NANNAVKNNNNEEPSDKHIEQYLNKIKNSI is a 30-residue synthetic peptide with the sequence Asn-Ala-Asn-Asn-Ala-Val-Lys-Asn-Asn-Asn-Asn-Glu-Glu-Pro-Ser-Asp-Lys-His-Ile-Glu-Gln-Tyr-Leu-Asn-Lys-Ile-Lys-Asn-Ser-Ile. Biotin provides an affinity handle for streptavidin-based capture or detection; an Ahx spacer separates the peptide from an attached label or affinity handle. The sequence contains 4 Lys and 0 Arg residues, contributing cationic character. These sequence-derived properties describe the reagent chemically; no specific receptor, enzyme, pathway, disease association, or biological activity is assigned without product-specific experimental evidence. |
Experimental Notes | Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended experimental conditions. |