My Account Information
Displaying 1 to 10 (of 7702 Products)
| Price | Product Name |
|---|---|
$590.00 ... more info |
Product Name SSTNIV Peptide Chimera Product Quantity 4 mg Catalog Number LT8316 Sequence LPAGEGPKEGEAVVLPEVEPGLTAREQENTAVVSVEADARNQAPVD Related Products Custom Peptide Synthesis Long Peptide Synthesis Peptide Conjugation... |
$350.00 ... more info |
Product Name Beta-Amyloid (31-40) Product Quantity 5 mg Catalog Number LT8315 Molecular Weight 912.16 Formula C44H82N10O11 Sequence Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val, IIGLMVGGVV Product Description Beta-Amyloid... |
$350.00 ... more info |
KL4 peptide KLLLLKLLLLKLLLLKLLLLK Product Name KL4 Peptide, KLLLLKLLLLKLLLLKLLLLK Catalog Number LT8313 Product Quantity 5 mg Purity >95% Molecular Weight 2469.44 Formula C126H238N26O22 Sequence KLLLLKLLLLKLLLLKLLLLK,... |
$262.00 $162.00Save: 38% off ... more info |
HIV-1 TAT-derived GRKKRRQRRRPQ Product NameTAT Cell-Penetrating Peptide, GRKKRRQRRRPQProduct Quantity5mg Catalog Number LT8314Molecular Weight 1621.93FormulaC65H124N34O15Sequence Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Arg-Pro-Gln, GRKKRRQRRRPQ Product Description The... |
$1,150.00 $999.00Save: 13% off ... more info |
Sortase Labeling Starter Kit All-in-one solution for Sortase A-mediated biotin labeling and flow cytometry detection Build a complete LPETG / Sortase A workflow with substrate, enzyme, and fluorescent detection—optimized for LIPSTIC assays ,... |
$380.00 ... more info |
Human Intracellular Sigma Peptide Product Name TAT-ISP Peptide, GRKKRRQRRRCDMAEHTERLKANDSLKLSQEYESI Product Quantity 4 mg Purity >95% Catalog Number LT8310 Sequence GRKKRRQRRRCDMAEHTERLKANDSLKLSQEYESI Product Description The peptide... |
$450.00 ... more info |
Catalog Number: LT8309 Category: self-peptide Sequence: Lys(N3)-GNYTCEVTELTREGETIIELK, CD47-derived peptide , Options to conjugate with DSPE-PEG-DBCO, MW 1,000, MW 2,000, or MW 3,400. Please quote for the conjugation service. Quantity: 4 mg ... |
$250.00 ... more info |
Product Name M9M Peptide, GGSYNDFGNYNNQSSNFGPMKGGNFGGRFEPYANPTKR Catalog Number LT8306 Quantity 1 mg Purity >95% Molecular Weight 4148.42 Formula C181H256N54O58S Sequence GGSYNDFGNYNNQSSNFGPMKGGNFGGRFEPYANPTKR Product... |
$350.00 ... more info |
Poly-L-Lysine, KKKKKKKKKKKK, K12 Product Name Polylysine, Poly-L-Lysine, KKKKKKKKKKKK, K12 Product Quantity 5 mg Purity >95% Catalog Number LT8307 Molecular Weight 1556.10 Formula C72H146N24O13 Sequence Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys,... |
$450.00 ... more info |
Product Name FITC-Ahx-CD47 Peptide, FITC-Ahx-GNYTCEVTELSREGKTVIELK Product Quantity 4 mg Purity >95% Catalog Number LT8308 Modification N-terminal FITC label with aminohexanoic acid (Ahx) linker Sequence ... |
Displaying 1 to 10 (of 7702 Products)
