My Account Information
Displaying 81 to 90 (of 7692 Products)
| Price | Product Name |
|---|---|
$180.00 ... more info |
Product Name GMC oxidoreductase [Streptomyces exfoliatus] Ac-KTYLAQAAATG-NH2 Product Quantity 4mg Purity >95% Catalog Number LT8223 Molecular Weight1135.29FormulaC50H82N14O16Sequence Ac-KTYLAQAAATG-NH2; Ac- Lys - Thr - Tyr - Leu - Ala - Gln -... |
$280.00 ... more info |
Product Name Chain E, Hiv-1 Nucleocapsid Zinc Finger [Human immunodeficiency virus 1]: WVKCFNCGKEGHIARNCRA Product Quantity 4mg Purity >95% Catalog Number LT8222 Molecular Weight2191.59FormulaC93H147N33O23S3Sequence WVKCFNCGKEGHIARNCRA Product... |
$380.00 $280.00Save: 26% off ... more info |
Product Name Ovalbumin(257-264) antigen peptide biotin- SIINFEKL Product Quantity 4mg Purity >99% Catalog Number LT8220 Molecular Weight1189.44FormulaC55H88N12O15SSequence biotin-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu, Biotin-SIINFEKL Product... |
$250.00 ... more info |
Product Name HIV-1 gag peptide: PEAIPMFSALSEGATPW Product Quantity 4mg, >95% Catalog Number LT8219 Formula C83H122N18O25S Molecular Weight 1804.05 Sequence PEAIPMFSALSEGATPW Product Description The HIV-1 Gag protein is... |
$250.00 ... more info |
Product Name AWVKVVEEKAFSPEVIPMF Product Quantity 4mg, >95% Catalog Number LT8218 Formula C106H160N22O27S Molecular Weight 2206.63 Sequence AWVKVVEEKAFSPEVIPMF Product Description Frequencies of Subtype-Specific Amino... |
$350.00 ... more info |
Product Name Neprilysin peptide: Biotin-ERIGYPDDIVSNDNKLNNEYLELNYKEDEYF Product Quantity 4mg Catalog Number LT8217 Formula C179H262N44O61S Molecular Weight 4038.37 Sequence Biotin-ERIGYPDDIVSNDNKLNNEYLELNYKEDEYF Product... |
$800.00 ... more info |
Curli production assembly transport protein CsgF Product Name Curli production assembly/transport protein CsgF [Escherichia coli] TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO) Product Quantity 4mg Catalog Number LT8216 Sequence Curli production assembly/transport protein CsgF... |
$1,200.00 ... more info |
cAMP-dependent protein kinase type II-alpha regulatory subunit Product Name Chain A, cAMP-dependent protein kinase type II-alpha regulatory subunit [Homo sapiens]: HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA Product Quantity 4mg Catalog Number LT8215 Sequence Chain A, cAMP-dependent protein kinase... |
$280.00 ... more info |
Product Name RAME (100-108) HLA-A*0201: VLDGLDVLL Product Quantity 4mg Catalog Number LT8214 Formula C44H77N9O14 Molecular Weight 956.15 Sequence RAME (100-108) HLA-A*0201: VLDGLDVLL Product Description PRAME (100-108)... |
$350.00 ... more info |
Product Name NRIP1_700_722: 5' FAM - GSEIENLLERRTVLQLLLGNPNK Product Quantity 4mg Catalog Number LT8212 Molecular Weight 2965.32 Formula C134H206N34O42 Sequence 5' FAM - GSEIENLLERRTVLQLLLGNPNK Product Description... |
Displaying 81 to 90 (of 7692 Products)
