cAMP-dependent protein kinase type II-alpha regulatory subunit

Chain A, cAMP-dependent protein kinase type II-alpha regulatory subunit [Homo sapiens]

cAMP-dependent protein kinase type II-alpha regulatory subunit is an enzyme that in humans is encoded by the PRKAR2A gene. The Lys(N3) modified peptide with spacer can be used for drug or compound conjugation using click chemistry.

Lys(N3)- spacer- HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA

The technique utilizes complementary protein binding domains, referred to as anchoring domains (AD) and dimerization and docking domains (DDD), which bind to each other and allow the assembly of complex structures, ranging from dimers, trimers, tetramers, quintamers and hexamers.

Exemplary DDD and AD sequences that may be utilized in the DNL method to form synthetic complexes are disclosed below.
(SEQ ID NO: 1)
DDD1 SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA
(SEQ ID NO: 2)
DDD2 CGHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA
(SEQ ID NO: 3)
AD1 QIEYLAKQIVDNAIQQA
(SEQ ID NO: 4)
AD2 CGQIEYLAKQIVDNAIQQAGC

The AD and/or DDD moiety may be attached to either the N-terminal or C-terminal end of an effector protein or peptide, such as an antibody or fragment.

Reference: https://patents.google.com/patent/US7999083B2/en

cAMP-dependent protein kinase type II-alpha regulatory subunit is a 43-residue synthetic peptide with the sequence His-Ile-Gln-Ile-Pro-Pro-Gly-Leu-Thr-Glu-Leu-Leu-Gln-Gly-Tyr-Thr-Val-Glu-Val-Leu-Arg-Gln-Gln-Pro-Pro-Asp-Leu-Val-Glu-Phe-Ala-Val-Glu-Tyr-Phe-Thr-Arg-Leu-Arg-Glu-Ala-Arg-Ala. The sequence contains 0 Lys and 4 Arg residues, contributing cationic character; contains 4 aromatic residues that can contribute to hydrophobic or aromatic interactions. These sequence-derived properties describe the reagent chemically; no specific receptor, enzyme, pathway, disease association, or biological activity is assigned without product-specific experimental evidence.

• LC-MS/HPLC analytical method development
• sequence-specific assay controls

Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended experimental conditions.