Chain A, cAMP-dependent protein kinase type II-alpha regulatory subunit [Homo sapiens] cAMP-dependent protein kinase type II-alpha regulatory subunit is an enzyme that in humans is encoded by the PRKAR2A gene. The Lys(N3) modified peptide with spacer can be used for drug or compound conjugation using click chemistry. Lys(N3)- spacer- HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA The technique utilizes complementary protein binding domains, referred to as anchoring domains (AD) and dimerization and docking domains (DDD), which bind to each other and allow the assembly of complex structures, ranging from dimers, trimers, tetramers, quintamers and hexamers. Exemplary DDD and AD sequences that may be utilized in the DNL method to form synthetic complexes are disclosed below. (SEQ ID NO: 1) DDD1 SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO: 2) DDD2 CGHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO: 3) AD1 QIEYLAKQIVDNAIQQA (SEQ ID NO: 4) AD2 CGQIEYLAKQIVDNAIQQAGC The AD and/or DDD moiety may be attached to either the N-terminal or C-terminal end of an effector protein or peptide, such as an antibody or fragment. Reference: https://patents.google.com/patent/US7999083B2/en |