Product Name | Curli production assembly transport protein CsgF |
Product Quantity | 4mg |
Catalog Number | LT8216 |
Sequence | Curli production assembly/transport protein CsgF [Escherichia coli] TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO) |
Product Description |
A key part of bacterial biofilms is the curli amyloid fibrils produced by the curli biogenesis system. Understanding how curli biogenesis works is crucial for developing treatments for biofilm-related infections. The curli biogenesis system was examined, focusing on the structure, chemistry, and function of the secretion channel complexes (CsgF-CsgG) with and without the curli substrate. A dual-pore design in the CsgF-CsgG complex was used to create a method for inhibiting curli secretion by physically reducing the size of the CsgF pore. It was discovered how CsgG recognizes the CsgA substrate. Nine crevices outside the CsgG channel serve as specific and highly conserved recognition sites for the CsgA N-terminus.
The curli production assembly/transport protein CsgF [Escherichia coli] can be conjugated with other compounds using click chemistry. TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO) |
Scientific Background | Curli production assembly transport protein CsgF is a 32-residue synthetic peptide with the sequence Thr-Phe-Gln-Phe-Arg-Asn-Pro-Asn-Phe-Gly-Gly-Asn-Pro-Ser-Asn-Gly-Ala-Phe-Leu-Leu-Asn-Ser-Ala-Gln-Ala-Gln-Asn-Ser-Tyr-Lys-Asp-Pro. DBCO provides a strained alkyne handle for copper-free click chemistry. The sequence contains 5 aromatic residues that can contribute to hydrophobic or aromatic interactions. These sequence-derived properties describe the reagent chemically; no specific receptor, enzyme, pathway, disease association, or biological activity is assigned without product-specific experimental evidence. |
Research Applications | - bioorthogonal or thiol-selective conjugation studies
- LC-MS/HPLC analytical method development
- sequence-specific assay controls
|
Experimental Notes | Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended experimental conditions. |
