My Account Information

Displaying 4921 to 4930 (of 7697 Products)
Price Product Name
$280.00
... more info

LLP(pT)APLSPSR

Catalog Number: 5899 Category: Peptide Sequence: LLP(pT)APLSPSR Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

LSEGLGELMQRCPSRLPG

Catalog Number: 5898 Category: Peptide Sequence: LSEGLGELMQRCPSRLPG Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

NKGLRNK

Catalog Number: LT5897 Category:Peptide Sequence: NKGLRNK Formula: C34H65N15O9 Quantity: 4mg Purity: >95% MW: 827.99 Description: Key Features : Targeted Action : NKGLRNK, a placental-homing peptide, is engineered to...
$280.00
... more info

CDEAGGATDPSCAYSSL

Catalog Number: 5896 Category: Peptide Sequence: CDEAGGATDPSCAYSSL Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

CDEAGGATDPSCAYSSL

Catalog Number: 5895 Category: Peptide Sequence: CDEAGGATDPSCAYSSL Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

TWQRRQRKDRRT

Catalog Number: 5894 Category: Peptide Sequence: TWQRRQRKDRRT Modifications: Quantity: 1-4mg Purity: >95% Notes:
$280.00
... more info

TWQRRQRKARRT

Catalog Number: 5893 Category: Peptide Sequence: TWQRRQRKARRT Modifications: Quantity: 1-4mg Purity: >95% Notes:
$280.00
... more info

SGTGGPGGGCGTGTGSGPGGTG

Catalog Number: 5892 Category: Peptide Sequence: SGTGGPGGGCGTGTGSGPGGTG Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00 $149.00Save: 47% off
... more info

MAADIISTIGDLVKWIIDTVNKFKK

Catalog Number: 5891 Category: Peptide Sequence:GspA: MAADIISTIGDLVKWIIDTVNKFKK Description: GLP-1 stimulating peptide (GspA) presents in GLP-1 positive but absents in GLP-1 neutral S. epidermidis. This novel S. epidermidis peptide modulates...
$580.00
... more info

{For}-MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF

Catalog Number: 5890 Category: Peptide Sequence: {For}-MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF Modifications: Quantity: 4mg Purity: >95% Notes:
Displaying 4921 to 4930 (of 7697 Products)