{For}-MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF

{For}-MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF is a 44-residue synthetic peptide with the sequence Met-Ser-Lys-Leu-Ala-Glu-Ala-Ile-Ala-Asn-Thr-Val-Lys-Ala-Ala-Gln-Asp-Gln-Asp-Trp-Thr-Lys-Leu-Gly-Thr-Ser-Ile-Val-Asp-Ile-Val-Glu-Ser-Gly-Val-Ser-Val-Leu-Gly-Lys-Ile-Phe-Gly-Phe. The sequence contains 4 Lys and 0 Arg residues, contributing cationic character; contains 3 aromatic residues; has a relatively high hydrophobic-residue fraction that can influence aqueous solubility and surface adsorption. These sequence-derived properties describe the reagent chemically; no specific biological activity is assigned without product-specific experimental evidence.

• LC-MS/HPLC analytical method development
• sequence-specific assay controls

Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended conditions.