My Account Information
Displaying 121 to 130 (of 7692 Products)
| Price | Product Name |
|---|---|
$350.00 ... more info |
AuBP1 peptide WAGAKRLVLRRE-C(Cy3) Catalog Number: LT36851 Category:Peptide Sequence: WAGAKRLVLRRE-C(Cy3) Formula: C104H158N28O19S Quantity: 1mg Purity: >95% MW: 2136.65 Description: Our WAGAKRLVLRRE-C(Cy3) Peptide is a cutting-edge biomimetic tool designed... |
$350.00 ... more info |
Catalog Number: LT5968 Category: A-beta T cell epitope Sequence: KLVFFAEDVGSNKGA Formula: C72H112N18O22 Quantity: 4mg Purity: >95% MW: 1581.79 Description: Our KLVFFAEDVGSNKGA Peptide is a state-of-the-art research tool... |
$250.00 $149.00Save: 40% off ... more info |
Product NameFmoc-C(Bhoc)-Aeg-OHProduct Quantity 1 GramCatalog Number LT-PNA007 Purity >95% CAS Number 186046-81-1 Molecular Formula C39H35N5O8 Molecular Weight 701.72 Description Description: Fmoc-PNA-C(Bhoc)-OH is designed for the... |
$250.00 $149.00Save: 40% off ... more info |
Product NameFmoc-G(Bhoc)-Aeg-OHProduct Quantity 1 GramCatalog Number LT-PNA006 Purity >95% CAS Number 186046-83-3 Molecular Formula C40H35N7O8 Molecular Weight 741.75 Description Description: Fmoc-PNA-G(Bhoc)-OH, representing the Guanine... |
$250.00 $149.00Save: 40% off ... more info |
Product NameFmoc-T-Aeg-OH; Fmoc-PNA-T-OHProduct Quantity 1 GramCatalog Number LT-PNA005 Purity >95% CAS Number 169396-92-3 Molecular Formula C26H26N4O7 Molecular Weight 506.51 Description Description: Fmoc-PNA-T-OH is a specialized monomer... |
$250.00 $149.00Save: 40% off ... more info |
Product NameFmoc-A(Bhoc)-Aeg-OHProduct Quantity 1 GramCatalog Number LT-PNA004 Purity >95% CAS Number 186046-82-2 Molecular Formula C40H35N7O7 Molecular Weight 725.75 Description Description: Fmoc-PNA-A(Bhoc)-OH is a specialized monomer... |
$1,200.00 ... more info |
Product Name (KFF)3K-PNA:KFFKFFKFFK-CTCATACTCTProduct Quantity 125nmolCatalog Number LT8195 Purity >95% Sequence KFFKFFKFFK-{CTCATACTCT}-NH2 Description The acpP-targeting antisense PNA CTCATACTCT, particularly when linked to the cell... |
$280.00 ... more info |
Catalog Number: LT8163 Category: Peptide Sequence:Low Molecular Weight Protamine (LMWP): VSRRRRRRGGRRRR Modifications: Low Molecular Weight Protamine (LMWP), with the sequence VSRRRRRRGGRRRR, is a peptide derived from protamine, a naturally... |
$350.00 ... more info |
Catalog Number: LT8227 Category: Peptide Sequence: Cy3-GISYGRKKRRQRRRAHQ, HIV TAT (48-60) variant from the core sequence GRKKRRQRRRPPQ Modifications: This is a cy3 labeled cell-penetrating peptides (CPPs) derived from the human... |
$350.00 $99.00Save: 72% off ... more info |
Corticotropin Releasing Factor, human, rat [86784-80-7] Catalog Number: LT8173 Category: Peptide Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, amidation Chemistry : Sequence:... |
Displaying 121 to 130 (of 7692 Products)
