My Account Information
Displaying 1421 to 1430 (of 7701 Products)
| Price | Product Name |
|---|---|
$390.00 ... more info |
Biotin-Ahx-PGSANKPKDQLNYENDIEKKICKMEKCSSV Catalog Number: 6249 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDQLNYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: 5265 Category: Peptide Sequence: biotin-Ahx-PPPPRGDRGDRGD-NH2 Modifications: Quantity: 9.9 mg Purity: >95% Formula: C72H116N26O22S Molecular Weight: 1729.94 Description: This peptide contains multiple repeats of... |
$250.00 ... more info |
Catalog Number: 5264 Category: Peptide Sequence: biotin-Ahx-RKKRRQRRR-NH2 Modifications: Quantity: 4 mg Purity: >95% Formula: C69H132N34O13S Molecular Weight: 1678.1 Description: RKKRRQRRR is a 9-amino acid peptide derived from... |
$250.00 ... more info |
Catalog Number: 5266 Category: Peptide Sequence: biotin-Ahx-RPARPAR-OH Modifications: Quantity: 4 mg Purity: >95% Formula: C50H87N19O11S Molecular Weight: 1162.43 Description: RPARPAR is an 8-amino acid peptide with the sequence... |
$280.00 ... more info |
Biotin-Ahx-YLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPC Catalog Number: 5688 Category: Peptide Sequence: Biotin-Ahx-YLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPC Modifications: Quantity: 4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: 5184 Category: Peptide Sequence: Biotin-AKEGVVAAAEKTKQGVAEAA Modifications: N-terminal Biotin, 1mg/vial Quantity: 1 mg Purity: >95% Formula: C98H167N27O32S Molecular Weight: 2267.63 For research purposes only! Not... |
$280.00 ... more info |
Catalog Number: 5747 Category: Peptide Sequence: Biotin-ALPETGG-NH2 Modifications: Quantity: 4mg Purity: >95% Molecular Weight: 868.99 Notes: Other related LPETG products: Cat. No Product Name Applications Price Order ... |
$608.00 ... more info |
Product Name Biotin-AMSYEGSWRAWVMWGGCG-NH2 Size 30 mg Catalog # LT441772 US$ $310 Purity 97.79% Description Biotin-AMSYEGSWRAWVMWGGCG-NH2, N-term Biotin; C-term NH2 Storage -20°C Sequence (One-Letter Code)... |
$1,224.72 ... more info |
Biotin-Amyloid Beta-Protein (1-40) Product NameBiotin-Amyloid Beta-Protein (1-40)Product Quantity5mgCatalog Number LT1076Molecular... |
$1,289.52 ... more info |
Biotin-Amyloid Beta-Protein (1-42) Product NameBiotin-Amyloid Beta-Protein (1-42)Product Quantity5mgCatalog Number LT1077Molecular... |
Displaying 1421 to 1430 (of 7701 Products)
