Scientific Background | Biotin-Ahx-YLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPC is a 36-residue synthetic peptide with the sequence Tyr-Leu-Ser-Thr-Asp-Val-Gly-Ser-Cys-Thr-Leu-Val-Cys-Pro-Leu-His-Asn-Gln-Glu-Val-Thr-Ala-Glu-Asp-Gly-Thr-Gln-Arg-Cys-Glu-Lys-Cys-Ser-Lys-Pro-Cys. Biotin provides an affinity handle for streptavidin-based capture or detection; An Ahx spacer separates the peptide from an attached label or handle. The sequence contains 5 cysteine residues, allowing thiol/disulfide chemistry when available; contains 2 Lys and 1 Arg residues, contributing cationic character. These sequence-derived properties describe the reagent chemically; no specific biological activity is assigned without product-specific experimental evidence. |
Experimental Notes | Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended conditions. |
