My Account Information
Displaying 4581 to 4590 (of 7696 Products)
| Price | Product Name |
|---|---|
$450.00 ... more info |
Catalog Number: 6215 Category: Peptide Sequence: EKRTRIPYKP NYSLNLWSIM KNCIGKELSK IPMPVNFNEP LSMLQRLTED LEYHE-Lys(Biotin) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
{Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRRPVGSENLYFQSYVGG-Lys(Biotin) Catalog Number: 6214 Category: Peptide Sequence: {Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRRPVGSENLYFQSYVGG-Lys(Biotin) Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus... |
$380.00 ... more info |
Biotin-Ahx-GGSENLYFQSYVGG-{Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRR Catalog Number: 6213 Category: Peptide Sequence: Biotin-Ahx-GGSENLYFQSYVGG-{Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRR Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus... |
$280.00 ... more info |
Catalog Number: 6212 Category: Peptide Sequence: FAM-MGVADLIKKFESIS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
DPDPENQRKTVRCFRCRQAGHWISDCRLKSK-Lys(FITC) Catalog Number: 6211 Category: Peptide Sequence: DPDPENQRKTVRCFRCRQAGHWISDCRLKSK-Lys(FITC) Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6210 Category: Peptide Sequence: GRKKRRQRRK-Lys(FITC) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
RQIKIWFQNRRMKWKKGGLHGRWFAGKMITAAYVPLHHHHHH Catalog Number: 6209 Category: Peptide Sequence: RQIKIWFQNR RMKWKKGGLH GRWFAGKMIT AAYVPLHHHH HH; NH2- Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Gly - Gly - Leu - His - Gly - Arg - Trp - Phe... |
$380.00 ... more info |
RQIKIWFQNR RMKWKKGGIH IYVDKNSAQG NVYVKCPSHH HHHH Catalog Number: 6208 Category: Peptide Sequence: RQIKIWFQNR RMKWKKGGIH IYVDKNSAQG NVYVKCPSHH HHHH; NH2- Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Gly - Gly - Ile - His - Ile - Tyr - Val -... |
$600.00 ... more info |
Recombinant Vascular Endothelial Growth Factor Agarose Catalog Number: LT12011-02 Packing Details: 3 ml prepacked column, or 5 ml prepacked column Support:6% highly cross-linked spherical agarose Ligand: Recombinant Vascular Endothelial Growth Factor Ligand Density: 0.25~1.0 mg/ml Particle... |
$600.00 ... more info |
Recombinant Human Fibroblast Growth Factor-basic Agarose Catalog Number: LT12012-02 Packing Details: 3 ml prepacked column, or 5 ml prepacked column Support:6% highly cross-linked spherical agarose Ligand: Recombinant Human Fibroblast Growth Factor-Basic Ligand Density: 0.25~1.0 mg/ml Particle... |
Displaying 4581 to 4590 (of 7696 Products)
