RQIKIWFQNRRMKWKKGGLHGRWFAGKMITAAYVPLHHHHHH

Product Name
RQIKIWFQNRRMKWKKGGLHGRWFAGKMITAAYVPLHHHHHH
Product Quantity
1mg
Catalog Number
6209
Category
Peptide
Sequence
RQIKIWFQNR RMKWKKGGLH GRWFAGKMIT AAYVPLHHHH HH; NH2- Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Gly - Gly - Leu - His - Gly - Arg - Trp - Phe - Ala - Gly - Lys - Met - Ile - Thr - Ala - Ala - Tyr - Val - Pro - Leu - His - His - His - His - His - His -COOH
Purity
>90%
Scientific Background

RQIKIWFQNRRMKWKKGGLHGRWFAGKMITAAYVPLHHHHHH is a synthetic penetratin cell-penetrating peptide-containing construct. This product contains penetratin, RQIKIWFQNRRMKWKK, a 16-residue cell-penetrating sequence derived from the Antennapedia homeodomain. Biophysical studies show that its cationic residues contribute strongly to membrane interaction and cellular internalization.

Research Applications
  • cellular uptake studies
  • cargo-delivery experiments
  • membrane-binding assays
  • cell-penetrating peptide structure-function studies
Experimental Notes

The behavior of a motif embedded in a longer peptide can differ from the isolated tag or parent sequence. Flanking residues, linkers, phosphorylation, fluorophores, affinity handles, cyclization, and terminal modifications may alter accessibility, binding, uptake, or assay performance.

Selected References
  1. Membrane interaction and cellular internalization of penetratin
  2. Benzophenone-based studies of penetratin membrane interactions
  • 1 Units in Stock
Ask a Question

$380.00

Add to Cart: