Scientific Background | RQIKIWFQNRRMKWKKGGLHGRWFAGKMITAAYVPLHHHHHH is a synthetic penetratin cell-penetrating peptide-containing construct. This product contains penetratin, RQIKIWFQNRRMKWKK, a 16-residue cell-penetrating sequence derived from the Antennapedia homeodomain. Biophysical studies show that its cationic residues contribute strongly to membrane interaction and cellular internalization. |
Experimental Notes | The behavior of a motif embedded in a longer peptide can differ from the isolated tag or parent sequence. Flanking residues, linkers, phosphorylation, fluorophores, affinity handles, cyclization, and terminal modifications may alter accessibility, binding, uptake, or assay performance. |