My Account Information

Displaying 4441 to 4450 (of 7696 Products)
Price Product Name
$1,080.00
... more info

GCRDGDQGIAGFDRCG

Product Name MMP-insensitive peptide crosslinker GCRDGDQGIAGFDRCG Size 1,000 mg Catalog # LT318475 US$ $900 Purity >85% Description MMP-insensitive peptide crosslinker GCRDGDQGIAGFDRCG Storage -20°C Sequence (One-Letter Code)...
$600.00 $400.00Save: 33% off
... more info

VPM peptide: GCRDVPMSMRGGDRCG

Product Name: VPM peptide: GCRDVPMSMRGGDRCG Size: 5 mg Catalog #: LT255422 Purity: >95% Description: VPM peptide, GCRDVPMSMRGGDRCG, a cysteine-containing biodegradable matrix metalloproteinase (MMP) crosslinker peptide, is an...
$1,440.00
... more info

H2N-GGYGGGPGPPGPPGPPGPPGPPGFOGERGPPGPPGPPGPPGPPGPC-CO2H

Product Name H2N-GGYGGGPGPPGPPGPPGPPGPPGFOGERGPPGPPGPPGPPGPPGPC-CO2H, O is hydroxyprolin Size 1,050 mg Catalog # LT441774 US$ $1,200 Purity >95% Description H2N-GGYGGGPGPPGPPGPPGPPGPPGFOGERGPPGPPGPPGPPGPPGPC-CO2H, O is hydroxyprolin ...
$1,440.00
... more info

GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG

Product Name NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer configuration Size 12 mg Catalog # LT441773 US$ $1,200 Purity >95% Description NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer...
$250.00
... more info

Gap 27, Connexin Mimetic SRPTEKTIFII

Product Name Gap 27, Connexin Mimetic SRPTEKTIFII Size 4 mg Catalog # LT53529 US$ $250 Purity >95% Description This peptide corresponds to the GAP27 domain of connexin. Connexins, or gap junctions, are a family of structurally related...
$220.00
... more info

Ni Sepharose FF Agarose

Catalog Number: LT22871 Data File: Packing Details: 1 mL resin, crosslinked 6% beaded agarose supplied as 50% slurry Binding Capacity: Binding Capacity:  60mg/mL of settled resin Support pH Stability: pH 3-9 ( 1 week at 4°C), pH 2-3 or...
$280.00
... more info

Biotin-Gly-His-Lys-OH

Catalog Number: 6351 Category: Peptide Sequence: Biotin-Gly-His-Lys-OH Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

Tripeptide-1-GHK

Catalog Number: 6350 Category: Tripeptide-1, CAS Number: 49557-75-7 Sequence: GHK; Gly-His-Lys Modifications: GHK is a peptide released during extracellular matrix (ECM) protein degradation following tissue injury. It binds to copper to form...
$280.00
... more info

Pal-Val-Gly-Val-Ala-Pro-Gly

Catalog Number: 6349 Category: Peptide Sequence: Pal-Val-Gly-Val-Ala-Pro-Gly Modifications: Quantity: 4mg Purity: >95% Notes:
$380.00
... more info

cyclo(RGDfK)*2

Catalog Number: 6348 Category: Peptide Sequence: cyclo(RGDfK)*2 Modifications: Quantity: 4mg Purity: >95% Notes:
Displaying 4441 to 4450 (of 7696 Products)