Product Name | GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG |
Catalog Number | LT441773 |
Purity | >95% |
Size | 12 mg |
Catalog # | LT441773 |
US$ | $1,200 |
Storage | -20°C |
Sequence (One-Letter Code) | NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer configuration |
Product Description | NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer configuration |
Scientific Background | GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG is a 41-residue synthetic peptide with the sequence Gly-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Arg-Gly-Ile-Glu-His-Ile-Ser-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly. The sequence is enriched in basic residues (2 Lys and 8 Arg), giving the sequence a cationic character under many aqueous conditions; contains 3 aromatic residues (Phe/Trp/Tyr), which can contribute to hydrophobic or aromatic interactions. No specific receptor, enzyme, pathway, disease association, or biological activity is assigned to this peptide without product-specific experimental evidence. |
Research Applications | - LC-MS/HPLC analytical method development
- sequence-specific assay controls
|
Experimental Notes | Sequence-derived chemical properties are provided to support reagent selection and experimental planning. They do not establish a biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended experimental conditions. |
