My Account Information

Displaying 4831 to 4840 (of 7697 Products)
Price Product Name
$280.00
... more info

SEVRSDR

Catalog Number: 5988 Category: Peptide Sequence: SEVRSDR Modifications: Quantity: 1-4mg Purity: >95% Notes:
$280.00
... more info

RLFDQFFGE

Catalog Number: 5987 Category: Peptide Sequence: RLFDQFFGE Modifications: Quantity: 1-4mg Purity: >95% Notes:
$320.00
... more info

PSFDSRHCIVKYV

Catalog Number: 5986 Category: Peptide Sequence: PSFDSRHCIVKYV Modifications: Quantity: 4mg Purity: >95% Notes:
$350.00
... more info

VCYDKSFPISHVR

Catalog Number: 5985 Category: Peptide Sequence: VCYDKSFPISHVR Modifications: Quantity: 4mg Purity: >95% Notes:
$550.00
... more info

Fmoc-Ala-Glu-Gly-Asp-OH

Catalog Number: 5984 Category: Peptide Sequence: Fmoc-Ala-Glu-Gly-Asp-OH Modifications: Quantity: 100mg Purity: >95% Notes:
$550.00
... more info

Fmoc-Asp-Gly-Glu-Ala-OH

Catalog Number: 5983 Category: Peptide Sequence: Fmoc-Asp-Gly-Glu-Ala-OH Modifications: Quantity: 100mg Purity: >95% Notes:
$280.00
... more info

GGG-Lys(Rhodamine B)

Catalog Number: 5982 Category: Peptide Sequence: GGG-Lys(Rhodamine B) Modifications: Quantity: 1-4mg Purity: >95% Notes:
$400.00
... more info

DPASNLGLEDIIRKALMGSFDDK

Catalog Number: 5981 Category: Peptide Sequence: DPASNLGLEDIIRKALMGSFDDK Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

LSPFRGRSR-{pSer}-APPNLWA

Catalog Number: 5980 Category: Peptide Sequence: LSPFRGRSR-{pSer}-APPNLWA Modifications: Quantity: 1-4mg Purity: >95% Notes:
$175.00
... more info

LL - 37,Cathelicidin, Antimicrobial Peptide, human

Product Name LL37, Cathelicidin, Antimicrobial Peptide, human Product Quantity 1 mg, 5 mg Purity >95% Catalog Number LT12016 Molecular Weight4493.37 FormulaC205H340N60O53Sequence (One-Letter Code)[LL-37, 37 aa] Sequence...
Displaying 4831 to 4840 (of 7697 Products)