Product Name | LL - 37, Cathelicidin, Antimicrobial Peptide, human |
Product Quantity | 1 mg, 5 mg |
Catalog Number | LT12016 |
Molecular Weight | 4493.37 |
Formula | C205H340N60O53 |
Purity | >95% |
Sequence (One-Letter Code) | [LL-37, 37 aa] |
Sequence (Three-Letter Code) | H - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - OH |
Product Description | Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). LL-37 is used to study host defense mechanisms. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. LL-37 is a multifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution. |
Scientific Background | LL - 37, Cathelicidin, Antimicrobial Peptide, human is a synthetic research peptide in the LL-37/cathelicidin antimicrobial peptide family. LL-37 is the 37-residue C-terminal antimicrobial peptide released from human hCAP18. It is amphipathic and cationic, interacts with microbial membranes, and has been widely studied for antimicrobial, antibiofilm, membrane, inflammatory, chemotactic, and wound-response activities. All-D LL-37 retains the same nominal sequence composition but has reversed stereochemistry and should be treated as a distinct research analog. |
Research Applications | - antimicrobial susceptibility assays
- membrane interaction and leakage studies
- biofilm research
- LL-37 analog and stereochemistry comparisons
|
Experimental Notes | The exact sequence, residue range, species, stereochemistry, terminal state, labels, and other modifications can materially affect activity. Match the supplied construct to the intended assay and published reference context. |
Selected References | - The human cathelicidin LL-37: a multifunctional peptide
- LL-37 membrane interactions
|
