My Account Information

Displaying 4581 to 4590 (of 7697 Products)
Price Product Name
$280.00
... more info

Biotin-EERHLSKMQQNGYENPTYKFFEQ

Catalog Number: 6216 Category: Peptide Sequence: Biotin-EERHLSKMQQNGYENPTYKFFEQ Modifications: Quantity: 4mg Purity: >95% Notes:
$450.00
... more info

OSBP isoform 3

Catalog Number: 6215 Category: Peptide Sequence: EKRTRIPYKP NYSLNLWSIM KNCIGKELSK IPMPVNFNEP LSMLQRLTED LEYHE-Lys(Biotin) Modifications: Quantity: 4mg Purity: >95% Notes:
$380.00
... more info

{Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRRPVGSENLYFQSYVGG-Lys(Biotin)

Catalog Number: 6214 Category: Peptide Sequence: {Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRRPVGSENLYFQSYVGG-Lys(Biotin) Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus...
$380.00
... more info

Biotin-Ahx-GGSENLYFQSYVGG-{Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRR

Catalog Number: 6213 Category: Peptide Sequence: Biotin-Ahx-GGSENLYFQSYVGG-{Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRR Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus...
$280.00
... more info

FAM-MGVADLIKKFESIS

Catalog Number: 6212 Category: Peptide Sequence: FAM-MGVADLIKKFESIS Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

DPDPENQRKTVRCFRCRQAGHWISDCRLKSK-Lys(FITC)

Catalog Number: 6211 Category: Peptide Sequence: DPDPENQRKTVRCFRCRQAGHWISDCRLKSK-Lys(FITC) Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

GRKKRRQRRK-Lys(FITC)

Catalog Number: 6210 Category: Peptide Sequence: GRKKRRQRRK-Lys(FITC) Modifications: Quantity: 4mg Purity: >95% Notes:
$380.00
... more info

RQIKIWFQNRRMKWKKGGLHGRWFAGKMITAAYVPLHHHHHH

Catalog Number: 6209 Category: Peptide Sequence: RQIKIWFQNR RMKWKKGGLH GRWFAGKMIT AAYVPLHHHH HH; NH2- Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Gly - Gly - Leu - His - Gly - Arg - Trp - Phe...
$380.00
... more info

RQIKIWFQNR RMKWKKGGIH IYVDKNSAQG NVYVKCPSHH HHHH

Catalog Number: 6208 Category: Peptide Sequence: RQIKIWFQNR RMKWKKGGIH IYVDKNSAQG NVYVKCPSHH HHHH; NH2- Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Gly - Gly - Ile - His - Ile - Tyr - Val -...
$600.00
... more info

Recombinant Vascular Endothelial Growth Factor Agarose

Catalog Number: LT12011-02 Packing Details: 3 ml prepacked column, or 5 ml prepacked column Support:6% highly cross-linked spherical agarose Ligand: Recombinant Vascular Endothelial Growth Factor Ligand Density: 0.25~1.0 mg/ml Particle...
Displaying 4581 to 4590 (of 7697 Products)