My Account Information

Displaying 4461 to 4470 (of 7697 Products)
Price Product Name
$576.00 $320.00Save: 44% off
... more info

Thiol-Activated Peptide Conjugation Magnetic Beads

Catalog Number: LT16323 Packing Details: 30mg, Lyophilized Powder The magnetic separator is not provided. Binding Capacity: 1-10 mg protein or 0.1-1mg peptide/30mg magnetic beads. Particle size: 1μm with 20 carbon linker Magnetic Beads,...
$280.00
... more info

AEDG

Catalog Number: 6339 Category: Peptide Sequence: AEDG Modifications: Quantity: 4mg Purity: >95% Notes:
$380.00
... more info

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Catalog Number: 6338 Category: Peptide Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Modifications: Quantity: 4mg Purity: >95% Notes:
$460.00
... more info

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Catalog Number: 6337 Category: Peptide Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

GSNKGAIIGLM

Catalog Number: 6336 Category: Peptide Sequence: GSNKGAIIGLM Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Catalog Number: 6335 Category: Peptide Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

DRVYIHPF

Catalog Number: 6333 Category: Peptide Sequence: DRVYIHPF Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

DYKDDDDK

Catalog Number: 6332 Category: Peptide Sequence: DYKDDDDK Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

Palm-Lys-Val-Lys

Catalog Number: 6331 Category: Peptide Sequence:Palmitoyl Tripeptide-5; Palm-Lys-Val-Lys Modifications: Palmitoyl tripeptide-5 is a cosmeceutical peptide. Quantity: 5mg, gram or kilogram scale peptides available upon request Purity: 98 %...
$280.00
... more info

Ac-_-Ala-His-Ser-His

Catalog Number: 6330 Category: Peptide Sequence: Ac-_-Ala-His-Ser-His Modifications: Quantity: 4mg Purity: >95% Notes:
Displaying 4461 to 4470 (of 7697 Products)