My Account Information

Displaying 91 to 100 (of 7701 Products)
Price Product Name
$350.00
... more info

synuclein GSKTKEGVVHGVATVA

Product Name synuclein: Biotin-GSKTKEGVVHGVATVA Product Quantity 4mg Purity >95% Catalog Number LT8213 Molecular Weight1766.05FormulaC76H128N22O24SSequence Biotin-GSKTKEGVVHGVATVA Product Description α-Synuclein (α-syn) is a small...
$180.00
... more info

KTYLAQAAATG

Product Name GMC oxidoreductase [Streptomyces exfoliatus] Ac-KTYLAQAAATG-NH2 Product Quantity 4mg Purity >95% Catalog Number LT8223 Molecular Weight1135.29FormulaC50H82N14O16Sequence Ac-KTYLAQAAATG-NH2; Ac- Lys - Thr - Tyr - Leu - Ala - Gln -...
$280.00
... more info

WVKCFNCGKEGHIARNCRA

Product Name Chain E, Hiv-1 Nucleocapsid Zinc Finger [Human immunodeficiency virus 1]: WVKCFNCGKEGHIARNCRA Product Quantity 4mg Purity >95% Catalog Number LT8222 Molecular Weight2191.59FormulaC93H147N33O23S3Sequence WVKCFNCGKEGHIARNCRA Product...
$380.00 $280.00Save: 26% off
... more info

biotin-SIINFEKL

Product Name Ovalbumin(257-264) antigen peptide biotin- SIINFEKL Product Quantity 4mg Purity >99% Catalog Number LT8220 Molecular Weight1189.44FormulaC55H88N12O15SSequence biotin-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu, Biotin-SIINFEKL Product...
$250.00
... more info

PEAIPMFSALSEGATPW

Product Name HIV-1 gag peptide: PEAIPMFSALSEGATPW Product Quantity 4mg, >95% Catalog Number LT8219 Formula C83H122N18O25S Molecular Weight 1804.05 Sequence PEAIPMFSALSEGATPW Product Description The HIV-1 Gag protein is...
$250.00
... more info

AWVKVVEEKAFSPEVIPMF

Product Name AWVKVVEEKAFSPEVIPMF Product Quantity 4mg, >95% Catalog Number LT8218 Formula C106H160N22O27S Molecular Weight 2206.63 Sequence AWVKVVEEKAFSPEVIPMF Product Description Frequencies of Subtype-Specific Amino...
$350.00
... more info

Neprilysin

Product Name Neprilysin peptide: Biotin-ERIGYPDDIVSNDNKLNNEYLELNYKEDEYF Product Quantity 4mg Catalog Number LT8217 Formula C179H262N44O61S Molecular Weight 4038.37 Sequence Biotin-ERIGYPDDIVSNDNKLNNEYLELNYKEDEYF Product...
$800.00
... more info

Curli production assembly transport protein CsgF

Product Name Curli production assembly/transport protein CsgF [Escherichia coli] TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO) Product Quantity 4mg Catalog Number LT8216 Sequence Curli production assembly/transport protein CsgF...
$1,200.00
... more info

cAMP-dependent protein kinase type II-alpha regulatory subunit

Product Name Chain A, cAMP-dependent protein kinase type II-alpha regulatory subunit [Homo sapiens]: HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA Product Quantity 4mg Catalog Number LT8215 Sequence Chain A, cAMP-dependent protein kinase...
$280.00
... more info

VLDGLDVLL

Product Name RAME (100-108) HLA-A*0201: VLDGLDVLL Product Quantity 4mg Catalog Number LT8214 Formula C44H77N9O14 Molecular Weight 956.15 Sequence RAME (100-108) HLA-A*0201: VLDGLDVLL Product Description PRAME (100-108)...
Displaying 91 to 100 (of 7701 Products)