My Account Information
Displaying 6031 to 6040 (of 7701 Products)
| Price | Product Name |
|---|---|
$226.80 ... more info |
Product NamePeptide TProduct Quantity5mgCatalog Number LT2035Molecular Weight857.8FormulaC35H55N9O16SequenceAla-Ser-Thr-Thr-Thr-Asn-Tyr-Thr |
$1,140.00 ... more info |
Peptide Vaccine Testing Samples The SARS-CoV-2 virus (a.k.a. 2019-nCoV; disease: COVID-19) is responsible for the plague year of 2020. The Pfizer-BioNTech and Moderna mRNA vaccines have now been approved for emergency use and more are coming down the pipeline. The best vaccine... |
$447.12 ... more info |
Peptide YY (13-36) (canine,mouse, porcine, rat) Product NamePeptide YY (13-36) (canine,mouse, porcine, rat)Product Quantity5mgCatalog Number LT2036Molecular Weight3014.4FormulaC135H209N41O38SequenceSer-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
$280.00 ... more info |
Product Name Peptide YY (3-36) (human) Product Description PYY (3-36) (human), with the sequence IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 and a molecular weight of 4049.52 g/mol, is a biologically active peptide derived from the human... |
$350.00 $99.00Save: 72% off ... more info |
Catalog Number: LT8171 Category: Peptide Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, amidation Chemistry : Sequence:... |
$881.28 ... more info |
Peptide YY (canine, mouse,porcine, rat) Product NamePeptide YY (canine, mouse,porcine, rat)Product Quantity5mgCatalog Number LT2038Molecular... |
$881.28 ... more info |
Product NamePeptide YY, HumanProduct Quantity5mg Product Description Peptide YY (PYY) is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent. Catalog... |
$835.92 ... more info |
Product NamePeptide YY(3-36), PYY, humanProduct Quantity5mgCatalog Number LT2039Molecular... |
$186.00 ... more info |
Product Name Peptide Z Product Description Ac-FKGGGERCGGGGKKKAAAALLAAAAAAALLAAAKK-NH2 Product Quantity 1.0 mg Purity 95.59% Catalog Number LT12020 Molecular Weight 3210.86 FormulaC141H245N45038S1... |
$205.20 ... more info |
Product NameModulating Peptide, C-Terminal FragmentProduct Quantity10mgCatalog Number LT1848Molecular Weight545.65FormulaC25H39N9O5SequencePro-Gln-Arg-Phe-NH2 |
Displaying 6031 to 6040 (of 7701 Products)
