My Account Information
Displaying 4911 to 4920 (of 7701 Products)
| Price | Product Name |
|---|---|
$175.00 ... more info |
LL - 37,Cathelicidin, Antimicrobial Peptide, human Product Name LL37, Cathelicidin, Antimicrobial Peptide, human Product Quantity 1 mg, 5 mg Purity >95% Catalog Number LT12016 Molecular Weight4493.37 FormulaC205H340N60O53Sequence (One-Letter Code)[LL-37, 37 aa] Sequence... |
$510.00 ... more infoMax: 5 |
LL-37 (All D amino acid), Antimicrobial Peptide, human Catalog #: LT12017 Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, All D amino acids MW: 4493.37 Quantity: 1 mg Purity: >90% by HPLC Appearance: Freeze dried solid Formula: C205H341N61O52 CAS: 143108-26-3 Solubility Soluble in... |
$881.28 ... more info |
Product NameLL - 37 pentamideProduct Quantity5mgCatalog Number LT1757Molecular... |
$780.00 ... more info |
LL-37, Antimicrobial Peptide, human Product Name LL-37, Antimicrobial Peptide, humanProduct Description LL-37 is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. In addition to its antimicrobial activities, LL-37 has been found to... |
$881.28 ... more info |
Product NameLL - 37, reverse sequenceProduct Quantity5mgCatalog Number LT1759Molecular... |
$280.00 ... more info |
LLADFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Catalog Number: 5757 Category: Peptide Sequence: LLADFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6103 Category: Peptide Sequence: LLALTLAWSPRCRTTTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6104 Category: Peptide Sequence: LLALTLAWSPRCRWRLR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6102 Category: Peptide Sequence: LLALTLAWSPRCTPRSY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6106 Category: Peptide Sequence: LLASGAGRMPVCCSNEN Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4911 to 4920 (of 7701 Products)
