LL-37, Antimicrobial Peptide, human

Product Name
LL-37, Antimicrobial Peptide, human
Product Description

LL-37 is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria, such as Pseudomonas aeruginosa, Staphylococcus aureus, Staphylococcus epidermidis.

LL-37, also known as cathelicidin antimicrobial peptide LL-37, is a multifunctional peptide that plays pivotal roles in innate immunity, wound healing, and inflammation modulation. Here's a detailed description of its functions, usage, applications, and significance in biological studies:

  1. Antimicrobial Activity: LL-37 exhibits potent antimicrobial properties against a wide range of pathogens, including Gram-positive and Gram-negative bacteria, fungi, and some viruses. It acts by disrupting microbial membranes, leading to cell lysis and death. This antimicrobial activity makes it a promising candidate for the development of novel antimicrobial agents to combat antibiotic-resistant pathogens.

  2. Immunomodulation: LL-37 acts as an immunomodulatory molecule, regulating various aspects of the immune response. It can stimulate chemotaxis and activation of immune cells such as neutrophils, monocytes, and T cells. Additionally, LL-37 can modulate cytokine production and influence the balance between pro-inflammatory and anti-inflammatory responses. This immunomodulatory function makes it relevant for therapeutic applications in immune-related disorders and inflammatory conditions.

  3. Wound Healing: LL-37 promotes wound healing by accelerating the migration and proliferation of keratinocytes, endothelial cells, and fibroblasts. It also exhibits angiogenic properties, facilitating the formation of new blood vessels in injured tissues. Due to its wound healing abilities, LL-37 has potential applications in the development of wound dressings and regenerative medicine approaches.

  4. Applications: LL-37 has been studied extensively for its potential therapeutic applications in various medical fields. These include:

    • Infectious Diseases: LL-37-derived peptides or analogs are being investigated as alternative antimicrobial agents to combat bacterial and fungal infections, particularly those caused by multidrug-resistant pathogens.

    • Inflammatory Disorders: LL-37 has shown promise in preclinical studies for the treatment of inflammatory conditions such as psoriasis, inflammatory bowel disease, and arthritis. Its immunomodulatory properties make it a potential candidate for controlling excessive inflammation.

    • Wound Healing: LL-37-based therapies are being explored for promoting wound healing and tissue regeneration in chronic wounds, burns, and other types of skin injuries.

    • Cancer Therapy: LL-37 exhibits anticancer properties by inducing apoptosis in cancer cells and inhibiting tumor growth and metastasis in preclinical models. It is being investigated as a potential adjunctive therapy for various types of cancer.

    • Drug Delivery: LL-37 can also be used as a carrier molecule for delivering therapeutic agents to target cells or tissues due to its cell-penetrating properties.

  5. Significance in Biological Studies: LL-37 has been a subject of extensive research in the fields of immunology, microbiology, and pharmacology. Studies focusing on its structure, mechanism of action, and therapeutic potential have provided valuable insights into innate immunity, host-pathogen interactions, and the development of novel therapeutics. Additionally, LL-37 serves as a model peptide for understanding the structure-function relationships of antimicrobial peptides and designing improved peptide-based drugs.

LL-37 is a versatile peptide with diverse biological functions and therapeutic potential. Its antimicrobial, immunomodulatory, and wound healing properties make it an attractive candidate for the development of new treatments for infectious diseases, inflammatory disorders, wound management, and cancer therapy. Ongoing research continues to uncover its mechanisms of action and explore its applications in various biomedical fields.

Product Quantity
10mg
Catalog Number
LT1758
Molecular Weight
4493.37
Formula
C205H340N60O53
Sequence
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser, LLGDFFRKSK EKIGKEFKRI VQRIKDFLRN LVPRTES, LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 5 Units in Stock

Ask a Question

$780.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Logo 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2025 LifeTein.com. Powered by LifeTein