LL-37, Antimicrobial Peptide, human

(image for) LL-37, Antimicrobial Peptide, human
Product Name
LL-37, Antimicrobial Peptide, human
Product Quantity
10mg
Catalog Number
LT1758
Molecular Weight
4493.37
Formula
C205H340N60O53
Sequence
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser, LLGDFFRKSK EKIGKEFKRI VQRIKDFLRN LVPRTES, [LL-37, 37 aa]
Product Description

LL-37 is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria, such as Pseudomonas aeruginosa, Staphylococcus aureus, Staphylococcus epidermidis.

LL-37, also known as cathelicidin antimicrobial peptide LL-37, is a multifunctional peptide that plays pivotal roles in innate immunity, wound healing, and inflammation modulation. Here's a detailed description of its functions, usage, applications, and significance in biological studies:

  1. Antimicrobial Activity: LL-37 exhibits potent antimicrobial properties against a wide range of pathogens, including Gram-positive and Gram-negative bacteria, fungi, and some viruses. It acts by disrupting microbial membranes, leading to cell lysis and death. This antimicrobial activity makes it a promising candidate for the development of novel antimicrobial agents to combat antibiotic-resistant pathogens.

  2. Immunomodulation: LL-37 acts as an immunomodulatory molecule, regulating various aspects of the immune response. It can stimulate chemotaxis and activation of immune cells such as neutrophils, monocytes, and T cells. Additionally, LL-37 can modulate cytokine production and influence the balance between pro-inflammatory and anti-inflammatory responses. This immunomodulatory function makes it relevant for therapeutic applications in immune-related disorders and inflammatory conditions.

  3. Wound Healing: LL-37 promotes wound healing by accelerating the migration and proliferation of keratinocytes, endothelial cells, and fibroblasts. It also exhibits angiogenic properties, facilitating the formation of new blood vessels in injured tissues. Due to its wound healing abilities, LL-37 has potential applications in the development of wound dressings and regenerative medicine approaches.

  4. Applications: LL-37 has been studied extensively for its potential therapeutic applications in various medical fields. These include:

    • Infectious Diseases: LL-37-derived peptides or analogs are being investigated as alternative antimicrobial agents to combat bacterial and fungal infections, particularly those caused by multidrug-resistant pathogens.

    • Inflammatory Disorders: LL-37 has shown promise in preclinical studies for the treatment of inflammatory conditions such as psoriasis, inflammatory bowel disease, and arthritis. Its immunomodulatory properties make it a potential candidate for controlling excessive inflammation.

    • Wound Healing: LL-37-based therapies are being explored for promoting wound healing and tissue regeneration in chronic wounds, burns, and other types of skin injuries.

    • Cancer Therapy: LL-37 exhibits anticancer properties by inducing apoptosis in cancer cells and inhibiting tumor growth and metastasis in preclinical models. It is being investigated as a potential adjunctive therapy for various types of cancer.

    • Drug Delivery: LL-37 can also be used as a carrier molecule for delivering therapeutic agents to target cells or tissues due to its cell-penetrating properties.

  5. Significance in Biological Studies: LL-37 has been a subject of extensive research in the fields of immunology, microbiology, and pharmacology. Studies focusing on its structure, mechanism of action, and therapeutic potential have provided valuable insights into innate immunity, host-pathogen interactions, and the development of novel therapeutics. Additionally, LL-37 serves as a model peptide for understanding the structure-function relationships of antimicrobial peptides and designing improved peptide-based drugs.

LL-37 is a versatile peptide with diverse biological functions and therapeutic potential. Its antimicrobial, immunomodulatory, and wound healing properties make it an attractive candidate for the development of new treatments for infectious diseases, inflammatory disorders, wound management, and cancer therapy. Ongoing research continues to uncover its mechanisms of action and explore its applications in various biomedical fields.

Scientific Background

LL-37, Antimicrobial Peptide, human is a synthetic research peptide in the LL-37/cathelicidin antimicrobial peptide family. LL-37 is the 37-residue C-terminal antimicrobial peptide released from human hCAP18. It is amphipathic and cationic, interacts with microbial membranes, and has been widely studied for antimicrobial, antibiofilm, membrane, inflammatory, chemotactic, and wound-response activities. All-D LL-37 retains the same nominal sequence composition but has reversed stereochemistry and should be treated as a distinct research analog.

Research Applications
  • antimicrobial susceptibility assays
  • membrane interaction and leakage studies
  • biofilm research
  • LL-37 analog and stereochemistry comparisons
Experimental Notes

The exact sequence, residue range, species, stereochemistry, terminal state, labels, and other modifications can materially affect activity. Match the supplied construct to the intended assay and published reference context.

Selected References
  1. The human cathelicidin LL-37: a multifunctional peptide
  2. LL-37 membrane interactions
  • 5 Units in Stock
Ask a Question

$780.00

Add to Cart: